...

Estudi del valor terapèutic de la proteïna S100A7 Laura Padilla García

by user

on
Category: Documents
3

views

Report

Comments

Transcript

Estudi del valor terapèutic de la proteïna S100A7 Laura Padilla García
Estudi del valor terapèutic de la proteïna S100A7
en el desenvolupament tumoral
Laura Padilla García
ADVERTIMENT. La consulta d’aquesta tesi queda condicionada a l’acceptació de les següents condicions d'ús: La difusió
d’aquesta tesi per mitjà del servei TDX (www.tdx.cat) i a través del Dipòsit Digital de la UB (diposit.ub.edu) ha estat
autoritzada pels titulars dels drets de propietat intel·lectual únicament per a usos privats emmarcats en activitats
d’investigació i docència. No s’autoritza la seva reproducció amb finalitats de lucre ni la seva difusió i posada a disposició
des d’un lloc aliè al servei TDX ni al Dipòsit Digital de la UB. No s’autoritza la presentació del seu contingut en una finestra
o marc aliè a TDX o al Dipòsit Digital de la UB (framing). Aquesta reserva de drets afecta tant al resum de presentació de
la tesi com als seus continguts. En la utilització o cita de parts de
la tesi és obligat indicar el nom de la persona autora.
ADVERTENCIA. La consulta de esta tesis queda condicionada a la aceptación de las siguientes condiciones de uso: La
difusión de esta tesis por medio del servicio TDR (www.tdx.cat) y a través del Repositorio Digital de la UB
(diposit.ub.edu) ha sido autorizada por los titulares de los derechos de propiedad intelectual únicamente para usos
privados enmarcados en actividades de investigación y docencia. No se autoriza su reproducción con finalidades de lucro
ni su difusión y puesta a disposición desde un sitio ajeno al servicio TDR o al Repositorio Digital de la UB. No se autoriza
la presentación de su contenido en una ventana o marco ajeno a TDR o al Repositorio Digital de la UB (framing). Esta
reserva de derechos afecta tanto al resumen de presentación de la tesis como a sus contenidos. En la utilización o cita de
partes de la tesis es obligado indicar el nombre de la persona autora.
WARNING. On having consulted this thesis you’re accepting the following use conditions: Spreading this thesis by the
TDX (www.tdx.cat) service and by the UB Digital Repository (diposit.ub.edu) has been authorized by the titular of the
intellectual property rights only for private uses placed in investigation and teaching activities. Reproduction with lucrative
aims is not authorized nor its spreading and availability from a site foreign to the TDX service or to the UB Digital
Repository. Introducing its content in a window or frame foreign to the TDX service or to the UB Digital Repository is not
authorized (framing). Those rights affect to the presentation summary of the thesis as well as to its contents. In the using or
citation of parts of the thesis it’s obliged to indicate the name of the author.
2015
Programa de Doctorat en Biomedicina
Facultat de Farmàcia
Estudi del valor terapèutic de la proteïna S100A7
en el desenvolupament tumoral
Memòria presentada per Laura Padilla García per optar al títol de doctora per la Universitat
de Barcelona.
Tesi doctoral realitzada sota la direcció del doctor José Luis Hernández Míguez, a la Divisió
Biomèdica del Centre Tecnològic LEITAT.
Tesi adscrita al Departament de Bioquímica i Biologia Molecular de la Facultat de Farmàcia
(Universitat de Barcelona).
José Luis
Carles J.
Laura
Hernández Míguez
Ciudad Gómez
Padilla García
Director
Tutor
Doctoranda
Barcelona, febrer del 2015
"No es pot desfer un nus sense saber com està fet"
Aristòtil
384 - 322 a.C.
ABREVIATURES
ADC
De l’anglès Antib ody-Drug Conjugate
ADCC
De l’anglès Antib ody-Dependent Cellular
DMEM
De l’anglès Dulbecco's Modified Eagle's
Medium
Cytotoxicity
DMSO
Dimetilsulfòxid
AFP
De l’anglès Alpha-Fetoprotein
DNA
àcid desoxiribonucleic
AGE
De l’anglès Advanced Glycation End-
dNTP
desoxiribonucleòtid trifosfat
EBM
De l’anglès Endothelial Basal Medium
ECM
De l’anglès Extracellular Matrix
EGF
De l’anglès Epithelial Growth Factor
ELISA
De l’anglès Enzyme-Linked
product
ATCC
American Type Culture Collection
Bcl-2
De l’anglès B-cell lymphoma-2
bFGF
De l’anglès b asic Fib rob last Growth
Factor
Immunosorbent Assay
BMDC
De l’anglès Bone Marrow Derived Cell
BSA
Albúmina de sèrum boví
CAF
De l’anglès Cancer Associated fib rob last
ER
Receptor d’estrògens
CDC
De l’anglès Complement-Dependent
ESCC
De l’anglès Esophageal Squamous Cell
EMT
De l’anglès Epithelial-Mesenchymal
Transition
Carcinoma
Cytotoxicity
cDNA
DNA complementari
FCS
De l’anglès Fetal Cow Serum
CDR
De l’anglès Complementarity Determining
FGF
De l’anglès Fib roblast Growth Factor
FITC
isotiocianat de fluoresceïna
FR
De l’anglès Framework
Region
CEA
De l’anglès Carcinoembryonic Antigen
CFA
Adjuvant Complet de Freund
CML
De l'anglès Chronic Myeloid Leukemia
COX-2
Ciclooxigenasa-2
cp
cèl·lules/pou
CSC
De l’anglès Cancer Stem Cell
CTC
De l’anglès Circulating Tumor Cell
ctDNA
De l’anglès circulating tumor DNA
CTLA-4
De l’anglès Cytotoxic T Lymphocyte-
GM-CSF De l’anglès Granulocyte-Macrophage
Colony-Stimulating Factor
HACA
Antib ody
HAMA
De l’anglès Human Anti-Mouse Antib ody
HAT
Hipoxantina, Aminopterina, Timidina
HCC
De l’anglès Hepatocellular Carcinoma
HER2
De l’anglès Human Epidermal Growth
Factor Receptor 2
associated Antigen 4
Da
Daltons
DCIS
De l’anglès Ductal Carcinoma In situ
De l’anglès Human Anti-Chimeric
HMGB1
De l’anglès High Mob ility Group Box 1
HRP
De l’anglès Horseradish Peroxidase
HT
Hipoxantina, Timidina
HUVEC
De l’anglès Human Umb ilical Vein
Endothelial Cells
IARC
International Agency for Research on
NIH
National Institutes of Health
NK
De l’anglès Natural Killer
NR
anticòs no relacionat
NSCLC
De l'anglès Non-small-cell Lung
Cancer
ICAM-1
De l’anglès Intercellular Adhesion
Carcinoma
Molecule 1
ICQ
Immunocitoquímica
IFA
Adjuvant Incomplet de Freund
IFN-γ
Interferó gamma
IgG
Immunoglobulina G
IHC
Immunohistoquímica
IL
Interleucina
IPTG
De l’anglès isopropyl-D-thiogalacto-
OD
Densitat òptica
OMS
Organització Mundial de la Salut
PAC
De l’anglès Pancreatic Adenocarcinoma
PAI-1
De l’anglès Plasminogen Activator
Inhib ibor-1
PBS
De l’anglès Phosphate Buffered Saline
PCR
Reacció en cadena de la polimerasa
PD1
De l’anglès Programmed Death 1
PDGF
De l’anglès Platelet-derived Growth
pyranoside
Jab1
De l’anglès c-Jun activation domain
Factor
binding protein-1
PEG
Polietilenglicol
PET
Polyethylene terephthalate
PF4
De l’anglès Platelet Factor-4
Protein
PgR
Receptor de progesterona
De l’anglès metastatic Castration-
PIGF
De l’anglès Placenta Growth Factor
Resistant Prostate Cancer
PSA
De l’anglès Prostate Specific Antigen
De l’anglès Macrophage Colony-
PVDF
Polifluorur de vinilidè
RAGE
De l’anglès Receptor for Advanced
LOX
Lisil oxidasa
mAb
anticòs monoclonal
MCP
De l’anglès Monocyte Chemotactic
mCRPC
M-CSF
Stimulating Factor
MDSC
De l’anglès myeloid-derived suppressor
Glycation End-products
cells
MHCII
Complex Major d’Histocompatibilitat II
MMP
De l’anglès Matrix Metalloproteinase
mRNA
RNA missatger
MSC
De l’anglès Mesenchymal Stem Cell
MTT
3-(4,5-Dimethylthiazol-2-yl)-2,5Diphenyltetrazolium Bromide
MWco
De l’anglès Molecular Weight cut-off
NCI
National Cancer Institute
NGS
De l’anglès Next Generation Sequencing
RNA
àcid ribonucleic
ROS
espècies reactives d’oxigen
rpm
revolucions per minut
RTV
De l’anglès Relative Tumor Volume
SAA-3
De l’anglès Serum Amyloid A-3
SD
Desviació estàndard
SDF-1
De l’anglès Stromal cell-Derived Factor-1
SDS-PAGE
Polyacrylamide Gel Electrophoresis
SEM
De l’anglès Sodium Dodecyl Sulfate
Error estàndard de la mitjana
SNP
De l’anglès Single Nucleotide
Polymorphism
TAM
De l’anglès Tumor Associated
TNF
De l’anglès Tumor Necrosis Factor
tPA
De l’anglès tissue Plasminogen Activator
TSP-1
Trombospondina-1
VC AM-1
De l’anglès Vascular Cell Adhesion
Macrophage
TGFβ
De l’anglès Transforming Growth Factor
TGS
Tris-Glicina-SDS
TIMP
De l’anglès Tissue Inhibitor of
VEGF
Metalloproteinase
TMB
De l’anglès Tetramethylbenzidine
TME
De l'anglès Tumor Microenvironment
Molecule 1
De l’anglès Vascular Endothelial Growth
Factor
VL A-4
De l’anglès Very Late Antigen-4
α-SMA
De l’anglès α-Smoth Muscle Actin
ÍNDEX
1. INTRODUCCIÓ ..................................................................................................................... 3
1.1. El càncer ...................................................................................................................... 3
1.2. Biologia del càncer....................................................................................................... 5
1.2.1. Angiogènesi ........................................................................................................ 11
1.2.2. Invasió i metàstasi .............................................................................................. 15
1.2.2.1. El nínxol premetastàtic ............................................................................ 18
1.2.3. Inflamació protumoral ......................................................................................... 19
1.3. Família de les proteïnes S100 ................................................................................... 22
1.3.1. Estructura............................................................................................................ 22
1.3.2. Expressió............................................................................................................. 24
1.3.3. Funció.................................................................................................................. 26
1.3.3.1. Les proteïnes S100 en el desenvolupament tumoral ............................. 27
1.3.4. Les S100 com a biomarcadors ........................................................................... 30
1.3.5. Aproximacions terapèutiques relacionades amb les S100 ................................ 30
1.4. La proteïna S100A7 ................................................................................................... 31
1.4.1. Expressió i pronòstic ........................................................................................... 32
1.4.2. Funció.................................................................................................................. 33
1.5. Biomarcadors tumorals .............................................................................................. 36
1.6. Teràpia del càncer ..................................................................................................... 39
1.6.1. Desenvolupament d’anticossos monoclonals terapèutics ................................. 46
2. OBJECTIUS......................................................................................................................... 53
3. MATERIALS I MÈTODES ................................................................................................... 57
3.1. Clonatge, producció i purificació de la proteïna recombinant S100A7 ..................... 57
3.2. Generació i caracterització d’anticossos monoclonals específics per a la
proteïna S100A7 ........................................................................................................ 58
3.2.1. Obtenció de les línies d’hibridoma productores d’anticòs.................................. 58
3.2.2. Producció i purificació dels anticossos anti-S100A7.......................................... 60
3.2.3. Caracterització dels anticossos .......................................................................... 61
3.2.3.1. Determinació de l’isotip ........................................................................... 61
3.2.3.2. Especificitat ............................................................................................. 61
3.2.3.3. Sensibilitat ............................................................................................... 61
I
3.3. Línies cel·lulars i condicions de cultiu ....................................................................... 62
3.4. Tècniques de biologia molecular ............................................................................... 63
3.4.1. Assaig d’interacció proteïna-receptor per ELISA ............................................... 63
3.4.2. Sandwich ELISA ................................................................................................. 64
3.4.3. Estudi de l’expressió de proteïnes...................................................................... 65
3.4.3.1. Extracció de proteïnes a partir de cultiu cel·lular o de teixit................... 65
3.4.3.2. Quantificació de la concentració de proteïna ......................................... 65
3.4.3.3. Western blot ............................................................................................ 65
3.4.3.4. Immunodetecció ...................................................................................... 66
3.4.4. Immunocitoquímica ............................................................................................. 67
3.4.5. Array de citoquines ............................................................................................. 67
3.4.6. Zimografia en gelatina ........................................................................................ 68
3.4.7. Estudi de la secreció de GM-CSF per ELISA .................................................... 69
3.5. Estudis in vitro............................................................................................................ 70
3.5.1. Assaig de proliferació.......................................................................................... 70
3.5.2. Assaig d’adhesió ................................................................................................. 71
3.5.3. Assaig de migració.............................................................................................. 71
3.5.3.1. Migració de cèl·lula tumoral, endotelial i fibroblast................................. 71
3.5.3.2. Migració de monòcits .............................................................................. 72
3.5.4. Assaig de wound healing .................................................................................... 73
3.5.5. Assaig d’adhesió de cèl·lula immune a cèl·lula endotelial................................. 74
3.6. Estudis in vivo ............................................................................................................ 74
3.6.1. Animals d’experimentació i condicions d’estabulació ........................................ 74
3.6.2. Estudis de creixement tumoral ........................................................................... 75
3.6.2.1. Caracterització del creixement subcutani in vivo de la línia A431 ......... 75
3.6.2.2. Estudi d’eficàcia dels anticossos anti-S100A7 ....................................... 76
3.6.3. Estudi de metàstasi experimental....................................................................... 77
3.6.4. Obtenció de mostres ........................................................................................... 78
3.6.5. Anàlisis per immunohistoquímica ....................................................................... 79
3.6.5.1. Anàlisi de la vasculatura tumoral ............................................................ 79
3.6.5.2. Tinció d’hematoxilina/eosina ................................................................... 80
3.6.5.3. Anàlisi de la necrosi intratumoral ............................................................ 80
3.6.5.4. Anàlisi de marcadors específics ............................................................. 81
3.6.5.5. Anàlisi de la fibrosis hepàtica.................................................................. 82
3.7. Seqüenciació dels anticossos monoclonals anti-S100A7......................................... 83
II
3.7.1. Extracció del RNA i obtenció del cDNA.............................................................. 83
3.7.2. Seqüenciació....................................................................................................... 83
3.8. Anàlisi estadístic ........................................................................................................ 87
4. RESULTATS........................................................................................................................ 91
4.1. Obtenció de la proteïna recombinant S100A7 .......................................................... 91
4.2. Obtenció d’anticossos monoclonals específics contra la proteïna S100A7 ............. 93
4.3. Caracterització dels anticossos monoclonals anti-S100A7 i utilitat com a
eines de recerca......................................................................................................... 94
4.3.1. Utilitat dels anticossos per western blot ............................................................. 97
4.3.2. Ús dels anticossos per immunohistoquímica ..................................................... 97
4.3.3. Utilitat dels anticossos per immunocitoquímica ................................................. 98
4.3.4. Determinació de la sensibilitat dels anticossos monoclonals ............................ 99
4.3.5. Obtenció d'un kit de diagnòstic per S100A7 basat en la tècnica del
sandwich ELISA ................................................................................................ 100
4.4. Estudi de l’expressió de la S100A7 i el receptor RAGE a nivell cel·lular ............... 102
4.5. Estudi d’interacció de la S100A7 amb el receptor RAGE ....................................... 105
4.6. Estudi del paper de la S100A7 in vitro .................................................................... 113
4.6.1. Efecte de la S100A7 sobre la proliferació cel·lular .......................................... 113
4.6.2. Paper de la S100A7 com a proteïna d’adhesió................................................ 118
4.6.3. Efecte de la S100A7 sobre la mobilitat cel·lular............................................... 119
4.6.4. Estudi d’adhesió de la cèl·lula immunitària sobre la cèl·lula endotelial........... 128
4.6.5. Estudi dels factors regulats per la S100A7 ...................................................... 130
4.6.5.1. Anàlisi de les citoquines secretades en resposta a la S100A7............ 130
4.6.5.2. Estudi de la secreció del GM-CSF........................................................ 137
4.6.5.3. Estudi de la secreció de la MMP9 ........................................................ 140
4.7. Regulació de l’expressió de S100A7 in vitro en la línia A431................................. 144
4.8. Estudi d’eficàcia in vivo dels anticossos anti-S100A7 ............................................ 148
4.8.1. Caracterització del creixement subcutani de la línia tumoral A431 ................. 149
4.8.2. Estudi d’eficàcia amb els anti-S100A7 en el model subcutani de la A431 ...... 156
4.8.2.1. Anàlisi de l'efecte del tractament a nivell histològic ............................. 164
4.9. Efecte de la proteïna S100A7 sobre la preparació del nínxol premetastàtic.......... 168
4.10. Seqüenciació dels anticossos monoclonals anti-S100A7....................................... 172
4.11. Disseny de la forma humanitzada de l’anticòs 6F5 mitjançant el mètode de
CDR-grafting ............................................................................................................ 176
III
5. DISCUSSIÓ ....................................................................................................................... 181
5.1. Paper de la proteïna S100A7 en el microentorn tumoral........................................ 182
5.2. Prova de principi de la teràpia basada en anticossos monoclonals contra la
proteïna S100A7 ...................................................................................................... 191
5.3. La proteïna S100A7 com a biomarcador de diagnòstic tumoral............................. 198
6. CONCLUSIONS ................................................................................................................ 203
7. BIBLIOGRAFIA.................................................................................................................. 207
8. PUBLICACIONS I PATENTS ............................................................................................ 241
IV
Introducció
1
Introducció
1. INTRODUCCIÓ
1.1. El càncer
El terme càncer, o tumor maligne, engloba més de 100 malalties caracteritzades per
un creixement excessiu i descontrolat de les cèl·lules, que adquireixen la capacitat d’envair
el teixit contigu i colonitzar altres òrgans (NCI, Updated 03/07/2014).
El càncer es pot classificar en diferents tipus segons el seu origen:
x
Carcinoma: càncer que s’origina a la pell o al teixit que delimita o cobreix els
òrgans interns (cèl·lules epitelials). Aproximadament el 80% dels tumors malignes
tenen aquest origen. Existeixen diferents subtipus de carcinomes, incloent
adenocarcinomes, carcinomes de cèl·lula escamosa o epidermoide, carcinomes de
cèl·lula basal i melanomes.
x
Sarcoma: tumor originat als teixits connectius, tals com el cartílag, el greix, els
vasos sanguinis, el múscul o els ossos.
x
Leucèmia: càncer amb origen a la medul·la òssia, que produeix multitud de
cèl·lules sanguínies anormals, sense que existeixi tumoració.
x
Limfoma i mieloma: càncer que s’origina a les cèl·lules del sistema immunitari.
x
Càncer del sistema nerviós central: originat al cervell o a la medul· la espinal.
En els països desenvolupats, el càncer constitueix la segona causa de mort, només
per darrere de les malalties cardiovasculars. L’any 2012, arreu del món, es van diagnosticar
14.1 milions de nous casos de càncer, es van produir 8.2 milions de morts i hi havien 32.6
milions de persones malaltes de càncer (comptant els primers 5 anys des del diagnòstic)
(Globocan, 2012).
A escala mundial, el tipus de càncer amb major incidència en homes és el càncer de
pulmó, seguit del càncer de pròstata, el càncer colorectal i el càncer d’estómac. En canvi, en
dones, el tipus de càncer amb major incidència és el de mama, seguit del colorectal, el de
pulmó i el càncer de cèrvix (Figura 1) (Globocan, 2012).
L’enteniment dels mecanismes pels quals es dóna aquesta malaltia ha estat un dels
grans reptes de la recerca biomèdica en les darreres dècades. Des que el president dels
Estats Units, Richard Nixon, va declarar la “Guerra al Càncer”, l’any 1971, s’han produït
3
importants avenços en el camp de la biologia molecular i cel·lular que han donat lloc a nous
tractaments. Només als Estats Units, la inversió en la investigació contra el càncer ha
augmentat de 27 bilions de dòlars l’any 1990 a 90 l’any 2008 (Valastyan and Weinberg,
2011). Una inversió que s’ha traduït en un descens del 5% en la mortalitat (ajustat per edat i
grandària de la població) entre els anys 1950 i 2005 (Begley, 2008).
Figura 1. Incidència i mortalitat dels diferents tipus de càncer a nive ll mundial.
Dades de l’any 2012 obtingudes de Globoc an (IARC).
4
Introducció
Per tant, continuar avançant en la comprensió dels processos implicats en el
desenvolupament tumoral i la seva complexa regulació multicel·lular i multifactorial, donarà
lloc a noves oportunitats terapèutiques i a una major eficiència en la selecció dels
tractaments idonis per a cada pacient.
1.2. Biologia del càncer
La divisió cel·lular descontrolada pot donar lloc a tumors benignes, que no tenen
capacitat d’envair el teixit circumdant ni de colonitzar altres òrgans (Nault et al., 2013). En
canvi, els tumors malignes són aquells que tenen capacitat invasiva i que es poden estendre
a altres òrgans després de viatjar pel torrent sanguini o limfàtic (metàstasi), posant en perill
la vida del pacient (Hesketh, 2013).
El procés pel qual una cèl·lula normal es transforma en cancerosa s’anomena
carcinogènesi i es caracteritza per una successió de canvis i mutacions a nivell genètic i
epigenètic que reprogramen el seu comportament (Weinberg, 2013) (Figura 2).
Figura 2. Estadi s de la carcinogènesi.
Imatge obtinguda de LSU Healt h Sciences Center (New Orleans).
L’any 2000, Hanahan i Weinberg van publicar els Hallmarks of Cancer, on es
detallaven les successives capacitats que les cèl·lules normals havien d’adquirir per
esdevenir neoplàsiques: manteniment de senyals proliferatius, evasió de la supressió de
creixement, resistència a la mort cel·lular, immortalitat replicativa, inducció de l’angiogènesi i
activació de la invasió i la metàstasi (Hanahan and Weinberg, 2000). Des de llavors,
nombrosos estudis han desviat el focus d’atenció de les cèl·lules tumorals i s’han centrat a
estudiar les cèl·lules normals reclutades que, junt amb les cèl·lules neoplàsiques, componen
la massa tumoral (Quail and Joyce, 2013). Aquestes cèl·lules normals formen l’estroma
associat al tumor i participen activament en l’adquisició de les capacitats descrites en els sis
Hallmarks, o trets distintius. Precisament, l’any 2011, els dos autors van publicar una revisió
5
del seu primer treball, que afegia nous conceptes i alteracions importants per a la progressió
del tumor, dos dels quals es van centrar en el paper de la cèl·lula immune infiltrada al
microentorn tumoral: l’evasió de l’atac del sistema immune i la inflamació promotora del
tumor (Figura 3).
Figura 3. Alteracions de les condicions fi siològique s durant la progressió tumoral.
Imatge obtinguda de (Hanahan and Weinberg, 2011).
La proliferació està regulada per senyals positius i negatius que la cèl·lula integra per
decidir si inicia el cicle de divisió cel·lular o bé entra en un estat de senescència o apoptosi.
Els senyals positius venen donats en bona part per factors de creixement, com el EGF
(de l’anglès Epithelial Growth Factor), que, mitjançant la unió als seus receptors de
membrana, activen vies de senyalització que regulen el cicle cel·lular (Bonfil et al., 2007).
Aquests factors de creixement poden tenir el seu origen en l’estroma tumoral, tot i que, en
alguns casos, són les mateixes cèl·lules malignes les que els produeixen, donant lloc a una
activació autocrina de la proliferació (Kawaguchi and Kataoka, 2014). Un altre mecanisme
que deriva en una major capacitat proliferativa de les cèl·lules és l’augment de l’exposició en
membrana dels receptors de factors de creixement (Lemmon and Schlessinger, 2010). A
més, s’ha descrit, en alguns casos, una activació constitutiva dels components de les vies de
senyalització o una pèrdua de funció en els reguladors negatius, que dóna lloc a una
hiperproliferació independent del lligand (Perona, 2006).
6
Introducció
Els senyals negatius venen donats pels gens supressors de tumors, com la proteïna
del retinoblastoma (Rb) (Dick and Rubin, 2013) i la p53 (Lu et al., 2014), que limiten el
creixement cel·lular i la proliferació, al mateix temps que indueixen l’entrada de la cèl·lula en
apoptosi. En alguns tipus de càncer, s’ha descrit la pèrdua de funció d’aquests gens
supressors de tumors. Per exemple, la p53 es troba alterada en el càncer de cèrvix (Klug et
al., 2009), pàncrees (Sonoyama et al., 2011) o mama (Alawadi et al., 2011). Altres
mecanismes que inhibeixen el creixement cel·lular són els contactes cèl·lula-cèl·lula i la
senyalització via el TGFβ (de l’anglès Transforming Growth Factor beta) (Joyce et al., 2002).
L’alteració d’aquests mecanismes permeten a la cèl·lula tumoral continuar la seva
progressió.
A més d’evadir els senyals anticreixement i mantenir una senyalització proliferativa
positiva, les cèl·lules tumorals augmenten l’activitat de l’enzim telomerasa per escapar dels
límits normals de la replicació cel·lular (immortalitat) (Sekhri, 2014).
Els senyals de l’entorn i els danys a nivell de DNA poden activar la mort cel·lular
programada (apoptosi) de la cèl·lula tumoral (Surova and Zhivotovsky, 2013). Els
mecanismes per evadir aquesta mort inclouen, entre d’altres, la pèrdua de funció de p53 o
l’augment de l’expressió de membres antiapoptòtics de la família de Bcl-2 (Fulda, 2010).
Per últim, dues característiques clau en el desenvolupament dels tumors sòlids són: la
seva capacitat per induir la formació de vasculatura a partir de vasos preexistents
(angiogènesi) i l’activació de la seva capacitat invasiva i metastàtica. Aquestes dues
característiques seran desenvolupades àmpliament en propers apartats.
L’adquisició d’aquests sis trets distintius proposats inicialment per Hanahan i Weinberg
és possible gràcies a dues característiques facilitadores: 1) La inestabilitat genòmica, que
permet la introducció de mutacions i reordenaments cromosòmics que afavoreixen la
selecció d’aquelles cèl·lules amb avantatges per sobreviure en l’entorn local de la massa
tumoral (Ben-David, 2014). 2) La inflamació promoguda per les cèl·lules del sistema
immunitari i que pot ajudar en la progressió tumoral mitjançant la secreció de factors com el
EGF, el VEGF (de l’anglès Vascular Endothelial Growth Factor) o diverses proteases de la
matriu extracel·lular (Bondar and Medzhitov, 2013).
A més, en la darrera dècada, diferents estudis han mostrat la importància de dos trets
distintius no inclosos inicialment en els Hallmarks: 1) La reprogramació de l’energia
metabòlica a la cèl·lula (metabolic switch), que implica l'activació aberrant de la glucòlisi
aeròbica, la biosíntesi de novo de lípids i l’anaplerosi dependent de glutamina per donar
suport a la contínua proliferació cel·lular (Zhou et al., 2010). 2) L’evasió per part de les
7
cèl·lules tumorals de l’atac immune amb funció citotòxica, mitjançant, per exemple, la
secreció de TGFβ (Yang et al., 2010), que paralitza les cèl·lules T citotòxiques, o el
reclutament de cèl·lules inflamatòries immunosupressores com els limfòcits T reguladors
(Treg) o les MDSCs (de l’anglès Myeloid-Derived Suppressor Cells) (Mougiakakos et al.,
2010; Rolle et al., 2012).
El microentorn tumoral
Com s’ha dit anteriorment, nombrosos estudis han desviat l’atenció de la cèl·lula
tumoral per posar el seu focus en les cèl·lules i els components de l’estroma (Figura 4A). La
xarxa de comunicació paracrina que formen, permet a les cèl·lules malignes sobreviure i
adquirir les característiques enumerades a l’apartat anterior (Figura 4B) (Pietras and
Ostman, 2010). Alguns dels components d’aquest microentorn tumoral (TME) i les
interaccions que es donen entre ells són explicats amb més detall a continuació.
Matriu extracel·lular. Com en la resta de teixits, els tumors necessiten una xarxa
tridimensional de molècules que suportin la seva massa. Entre les molècules que
componen la matriu extracel·lular (ECM) es troben el col·lagen, la fibronectina, la
laminina o l’heparan sulfat (Lu et al., 2012). Aquesta matriu també serveix com a
reservori per a multitud de factors que s’alliberen en ser degradada per les proteases
provinents de les cèl·lules estromals o tumorals (Hubmacher and Apte, 2013;
Vlodavsky et al., 1991). A més, la degradació de la matriu és un pas necessari per al
moviment de les cèl·lules durant processos com l’angiogènesi o la metàstasi
(Oskarsson, 2013).
Cèl·lules mare tumorals. Tot i les controvèrsies al voltant de l’existència d’una
població com a tal de cèl·lules mare tumorals o CSC (de l’anglès Cancer Stem Cells), i
sobre l’especificitat dels marcadors per identificar-les, molts estudis suporten aquesta
idea (Shukla and Meeran, 2014). Les CSC tenen unes característiques funcionals
específiques com ara la capacitat d’autorenovació i el potencial de repoblació a llarg
termini, que les diferencien de la resta de cèl·lules tumorals (Atlasi et al., 2014). A més,
tenen una gran adaptabilitat a l’estrès del microentorn com la inflamació local, la
hipòxia, l’acidesa, l’escassetat de nutrients o les teràpies antitumorals. De fet, s’ha
descrit que aquesta resistència intrínseca, junt amb la seva plasticitat genètica, pot ser
la causa de les recidives en pacients de càncer (Cojoc et al., 2014; Sotiropoulou et al.,
2014).
8
Introducció
A
B
Figura 4. Components cel·lulars i le s seve s interaccions dins del microentorn
tumoral.
A) Cèl·lules especialitzades presents dins el t umor. B) Exemple de les i nteraccions
paracrines entre els diferents components del microentorn tumoral. Imatge obtinguda de
(Hanahan and Weinberg, 2011).
Fibroblasts associats al tumor. Els CAF (de l’anglès Cancer Associated Fibroblasts)
es troben en major o menor quantitat en tots els carcinomes, constituint en molts casos
el tipus majoritari de cèl·lula estromal (Aboussekhra, 2011). Dins el tumor, els
fibroblast tenen unes característiques particulars que els diferencien dels fibroblasts
que es troben en els teixits normals. Per exemple, tenen una major capacitat
proliferativa, una major producció de col·lagen i secreten multitud de factors de
creixement i altres moduladors de la matriu extracel·lular (Madar et al., 2013). Amb tot,
els CAF tenen un paper determinant en la progressió tumoral, donant suport a les
cèl·lules canceroses i contribuint a l’èxit de la malaltia (Kharaishvili et al., 2014). Fins a
la data, s’han proposat multitud de possibles orígens que donen lloc a aquesta
9
població de fibroblasts activats dins el tumor, des de cèl·lules mare mesenquimals
(MSC), fins a cèl·lules de la musculatura llisa, cèl·lules epitelials o fins i tot cèl·lules
endotelials, que, sota determinats estímuls, poden arribar a diferenciar-se en aquest
tipus cel·lular (Madar et al., 2013).
Cèl·lules endotelials i perícits. Perquè el tumor pugui créixer necessita l’aportació
d’oxigen i nutrients així com un sistema que li permeti l’evacuació de productes
metabòlics i CO 2. La vasculatura intratumoral compleix aquesta funció (Folkman,
1971). Existeixen multitud de factors que estimulen les cèl·lules endotelials a formar
aquests vasos dins el tumor, entre els quals destaquen el VEGF, el FGF (de l’anglès
Fibroblast Growth Factor) i l’angiopoietina, a més d’altres que les inhibeixen, com la
trombospondina-1 (TSP-1), l’angiostatina i l’endostatina, fet que mostra la complexitat
de la regulació d’aquest procés bàsic per a la progressió tumoral (Sakurai and Kudo,
2011). En connexió amb l’angiogènesi, un altre procés que està descrit per a multitud
de tumors sòlids i en què es troben implicades les cèl·lules endotelials és la
limfangiogènesi, o formació de vasos limfàtics (Stacker et al., 2014). Al contrari que els
vasos sanguinis, els vasos limfàtics es troben al voltant del tumor i rarament dins de la
massa tumoral, on l’elevada pressió intersticial fa que es col·lapsin (Fukumura et al.,
2010). Ambdues vies són aprofitades per les cèl·lules malignes per escapar del tumor
primari i establir-se en òrgans distants.
Al voltant del vasos sanguinis es troben els perícits, unes cèl·lules mesenquimals
especialitzades que donen suport estructural a la vasculatura i contribueixen a la seva
maduració funcional, mitjançant la senyalització a través de diferents factors de
creixement com el PDGF (de l’anglès Platelet-Derived Growth Factor), el VEGF, el
TGF-β i l’angiopoietina (Stapor et al., 2014). Aberracions en el diàleg establert entre
els perícits i les cèl·lules endotelials contribueixen a l’angiogènesi i la metàstasi (Raza
et al., 2010).
Cèl·lules immunes inflamatòries. Alguns investigadors han proposat la visió dels
tumors com a teixits amb inflamació crònica o ferides que mai arriben a curar-se
(Dvorak, 1986), on la infiltració de cèl·lules immunitàries és persistent (Schafer and
Werner, 2008). Aquestes cèl·lules tenen un paper dual i contraposat dins el tumor: les
cèl·lules T citotòxiques CD8+ i CD4+, juntament amb la producció d’interferó gamma
(IFN-γ), funcionen com les principals cèl·lules efectores immunes antitumorals, mentre
que els macròfags associats al tumor o TAMs (de l’anglès Tumor Associated
Macrophages) i les MDSC, junt amb les seves citoquines derivades (IL-6, TNFα, IL-1β,
10
Introducció
IL-23, etc.), són generalment reconeguts com a forces protumorals, tot i que existeixen
variacions en les seves funcions (Zamarron and Chen, 2011).
A causa de la major estabilitat genètica de l’estroma que suporta el creixement
tumoral, nombrosos estudis s’han centrat a trobar noves teràpies dirigides contra aquests
components, on hi ha una menor probabilitat que apareguin resistències. La disrupció de la
xarxa multidireccional de factors i senyals establerta entre els diferents tipus cel·lulars
desestabilitzaria el microentorn format, afectant la progressió de la cèl·lula tumoral.
1.2.1. Angiogènesi
L’observació que el creixement tumoral anava acompanyat d’un augment de la seva
vasculatura va ser feta per primer cop a finals del segle XIX per Rudolf Virchow i altres
científics alemanys (Ferrara, 2002). Aquesta idea va ser confirmada posteriorment per altres
investigadors, sembrant les bases perquè, l’any 1971, el Dr. Judah Folkman publiqués un
estudi en què identificava per primer cop un factor concret que promovia l’angiogènesi
tumoral (el VEGF) i hipotetitzava que el seu bloqueig podria ser una estratègia efectiva per
al tractament del càncer (Folkman, 1971). Des de llavors, i sobretot a partir dels anys
noranta, multitud de treballs han demostrat aquesta idea i han posat el seu focus a entendre
els mecanismes que regulen el procés de l’angiogènesi per tal de bloquejar el creixement
tumoral.
Durant l’embriogènesi, el desenvolupament de la vasculatura implica la creació de
cèl·lules endotelials que formen els nous vasos (vasculogènesi) i la ramificació a partir dels
ja preexistents (angiogènesi) (Patan, 2004). En l’edat adulta, però, aquests mecanismes
esdevenen quiescents i només s’activen de manera transitòria durant el cicle menstrual
(Shimizu et al., 2012) o la reparació de ferides (Greaves et al., 2013). En canvi, durant la
progressió tumoral, després d’un primer estadi premaligne, l’angiogènesi s’activa
(angiogenic switch) per suportar l’expansió del tumor (Hanahan and Folkman, 1996). A
banda d’aportar oxigen i nutrients a la massa tumoral i permetre l’evacuació de productes
nocius, la vasculatura també afavoreix el trànsit de cèl·lules cap a dins del tumor i
l’extravasació de les cèl·lules tumorals a la sang, per on viatjaran fins a òrgans secundaris
(metàstasi) (Hoeben et al., 2004). A la Figura 5 es mostra una visió esquemàtica de les
etapes del desenvolupament tumoral, el creixement i la metàstasi, on l’angiogènesi juga un
paper important.
Cal tenir en compte, però, que l’angiogènesi no és l’únic mecanisme que el tumor té
per incrementar l’arribada de nutrients (Alameddine et al., 2014). En alguns casos, és el
11
tumor qui dirigeix el seu creixement per tal d’envoltar vasos ja existents (vascular co-option)
(Leenders et al., 2002). Aquest procés va ser descrit per primera vegada en tumors
cerebrals, un dels òrgans més vascularitzats del cos (Valiente et al., 2014). Existeixen tres
processos que impliquen la formació de nous vasos: 1) l’angiogènesi, 2) la vasculogènesi
postnatal o reclutament de cèl·lules endotelials progenitores derivades de la medul·la òssia
(Asahara et al., 1999; Eguchi et al., 2007), i 3) la intussuscepció o formació d’una paret al
lumen d’un capil·lar per dividir-lo en dos (Hlushchuk et al., 2008; Patan et al., 1996). A més,
s’han descrit dos mecanismes que permeten la formació de vasos a partir de cèl·lules no
endotelials: el mimetisme vasculogènic (que implica la transdiferenciació de cèl·lules
tumorals) (Seftor et al., 2012) i la formació de mosaics vasculars (incorporació de cèl·lules
tumorals a la paret vascular) (di Tomaso et al., 2005).
Figura 5. Angiogènesi en el desenvolupament tumoral i la metàsta si.
Imatge obtinguda de (Hoeben et al., 2004).
La vasculatura intratumoral és aberrant en comparació amb la vasculatura del teixit
normal. En concret, es caracteritza per una excessiva ramificació, uns vasos distorsionats i
engrandits, un flux sanguini erràtic, microhemorràgies internes, una elevada permeabilitat
(per unions dèbils entre les cèl·lules endotelials i un recobriment discontinu de perícits) i uns
nivells anormals de proliferació/apoptosi de les cèl·lules endotelials (Nagy et al., 2010).
Totes aquestes característiques alteren el microentorn tumoral i influeixen sobre el
creixement i la progressió del càncer així com la seva resposta a les teràpies antitumorals
(Multhoff et al., 2014).
12
Introducció
Nombrosos estudis mostren que l’angiogènesi es regula pel balanç entre senyals
activadors i inhibidors (Sakurai and Kudo, 2011). Alguns d’ells es detallen a continuació:
Factors proangiogènics
Secretat tant per les cèl·lules tumorals com per l’estroma, el VEGF, també conegut
com VEGF-A, és el principal membre de la família del VEGF (composta pel VEGF-A,
VEGF-B, VEGF-C, VEGF-D i el factor de creixement placentari o PIGF) i el factor
proangiogènic més referenciat. Exerceix la seva funció a través de dos receptors: el
VEGFR1 (conegut com Flt-1) i el VEGFR2 (també anomenat KDR o Flk-1) (Stuttfeld
and Ballmer-Hofer, 2009). El splicing alternatiu del VEGF-A dóna lloc a sis isoformes
(121, 145, 165, 189 i 206) amb diferents característiques, sent el VEGF-145 la forma
majoritària (Shibuya, 2014). La interacció del VEGF-A amb els seus receptors promou
l’activació d’una cascada de missatgers secundaris i factors de transcripció, iniciant-se
així el programa genètic de l’angiogènesi. A més, indueix la síntesi i secreció d’altres
factors proangiogènics, que alhora estimulen la seva pròpia expressió, formant un
bucle positiu d’autoactivació (Rosen, 2002).
Un altre factor àmpliament estudiat és el FGF-2, o FGF bàsic (bFGF), una proteïna de
la família dels FGF, composta per 22 membres, que interaccionen amb 4 possibles
receptors (FGFRs) (Coleman et al., 2014). En molts tipus de tumors s’ha trobat una
sobreexpressió tant dels lligands com dels receptors de FGF, desregulant la
proliferació, la diferenciació i la supervivència de la cèl·lula tumoral i la proliferació i
organització de les cèl·lules endotelials (Beenken and Mohammadi, 2009).
Altres factors proangiogènics que es poden destacar són: el PDGF, que també juga un
paper important en la proliferació tumoral i en la regulació de la funció dels perícits i els
fibroblasts activats (Heldin, 2013); el TGF-β, que té un paper dual, induint l’arrest del
cicle cel·lular o la progressió del tumor, en funció dels senyals del microentorn
(Principe et al., 2014); i l’angiopoietina-2, una proteïna que promou l’organització
vascular a través de la interacció amb el receptor Tie-2 (Moss, 2013).
Per últim, l’acció dels enzims proteolítics que degraden la matriu extracel·lular és
essencial en el procés de l’angiogènesi, ja que possibiliten el moviment de les cèl·lules
endotelials i alliberen factors proangiogènics ancorats a les proteïnes de la matriu, com
el VEGF o el bFGF (Noel et al., 2012; Stupack and Cheresh, 2002). Hi ha almenys tres
grans famílies d’enzims proteolítics, entre les quals destaca la família de les
metal·loproteïnases de la matriu (MMP). Aquesta gran família consta de 23 formes
diferents amb un gran espectre d’activitats, que es poden classificar en col·lagenases,
13
gelatinases i estroimielisines (Chen et al., 2013). Tres membres de la família
destaquen per la seva importància en el procés angiogènic: la MMP-1 (col·lagenasa),
la MMP-2 i la MMP-9 (gelatinases). Aquestes metal·loproteïnases, com la resta de
membres de la família, són secretats al microentorn tumoral com a formes latents
(inactives) anomenades zimògens o pro-MMP. Per a la seva activació, és necessària
la proteòlisi d’un extrem de la proteïna que permet l’exposició del seu centre catalític
(Knapinska and Fields, 2012). S’han descrit multitud de factors que indueixen
l’expressió de les MMP, així com la seva activació, mentre que els TIMP (de l’anglès
Tissue Inhibitor of Metalloproteinase), són reguladors negatius de la seva activitat
(Ries, 2014).
Factors antiangiogènics
Els factors inhibidors de l’angiogènesi actuen sobre la cèl·lula endotelial, reduint la
mobilitat, la proliferació, la morfogènesi dels vasos o l’expressió de factors
proangiogènics (Sakurai and Kudo, 2011).
La disponibilitat d’alguns d’aquests factors, com l’endostatina, la tumstatina i
l’angiostatina es troba regulada per les MMP, ja que són generats a partir de la
degradació de proteïnes de la matriu extracel·lular com el col·lagen tipus IV i XVIII, el
plasminogen i el perlecan (Gialeli et al., 2011).
Altres factors antiangiogènics àmpliament estudiats són la TSP-1, el factor de
plaquetes-4 (PF4) o el fragment N-terminal de 16 KDa de la prolactina (Clapp et al.,
2006; Lopez-Dee et al., 2011; Wang and Huang, 2013). En concret, la TSP-1 va ser el
primer agent angiostàtic a ser descobert i és l’únic, junt amb el PF4, que no és
producte de la proteòlisi d’altres proteïnes (Bornstein, 2009).
Amb tot, la regulació de l’angiogènesi és un procés d’una gran complexitat en què la
integració de multitud de senyals per part de les cèl·lules endotelials determinarà la seva
resposta. A més, la combinació d’alguns senyals pot tenir efectes inesperats sobre la
cèl·lula. Per exemple, alguns estudis han descrit que la combinació de varis factors
proangiogènics, com el FGF i el PDGF o el FGF i el VEGF, poden induir un increment
sinèrgic de l’angiogènesi tumoral (Asahara et al., 1995; Sun et al., 2004).
14
Introducció
1.2.2. Invasió i metàstasi
La metàstasi representa el darrer pas en el procés multietapa de la progressió tumoral
i implica la disseminació de les cèl·lules canceroses cap a òrgans anatòmicament distants i
la subseqüent adaptació al microentorn del teixit (Robert, 2013). A més, és la principal causa
de mort entre els pacients malalts de càncer (per sobre del 90% del total de morts),
esdevenint el major repte en el tractament de la malaltia (OMS, 2014).
La cascada metastàtica en els carcinomes (Figura 6) és un complex procés que inclou
cinc passos: alteració de l’adhesió (invasió), intravasació, supervivència durant la circulació,
arrest en la microvasculatura i extravasació, i establiment a l’òrgan distant (colonització
metastàtica) (Klein, 2008; Steeg, 2006).
1
3
2
4
5
Figura 6. Etapes de la cascada metastàtica.
Imatge modificada de Cancer Met astasis (Writz Lab, setembre 2014).
1) Desadhesió/invasió. Les cèl·lules malignes del tumor primari perden els contactes
cèl·lula-cèl·lula (mitjançats per E-cadherina) i cèl·lula-matriu (mitjançats per integrines),
adquirint una major capacitat invasiva, procés anomenat transició epiteli-mesènquima
(EMT) (Kalluri and Weinberg, 2009; Steinestel et al., 2014). A més, aquestes cèl·lules
secreten metal·loproteïnases i altres enzims proteolítics que degraden la matriu
circumdant per permetre’n el moviment (invasió mesenquimal) (Ranjan and Kalraiya,
2014). Existeixen multitud de factors que indueixen el moviment i la invasió cel·lular, ja
sigui actuant directament sobre la cèl·lula tumoral o bé induint la infiltració de cèl·lules
immunes que ajuden a la degradació de la matriu extracel·lular (Brabek et al., 2010).
D’altra banda, s’ha descrit un segon tipus d’invasió independent de la proteòlisi de la
ECM, la invasió ameboide (Sabeh et al., 2009). Aquest tipus de moviment implica la
15
pèrdua de la polaritat per part de les cèl·lules tumorals i la ràpida unió-desunió a la
matriu, que permet el moviment a través dels canals de menor resistència dins la xarxa
del teixit. En funció dels senyals del microentorn, les cèl·lules tumorals poden alternar
ambdues estratègies invasives (Bravo-Cordero et al., 2012).
2) Intravasació. Gràcies a la capacitat invasiva adquirida, les cèl·lules tumorals
arriben a la proximitat dels vasos sanguinis o limfàtics, les parets dels quals travessen
(intravasació), per tal d’accedir al torrent circulatori (Mina and Sledge, 2011). En
aquest procés són importants una sèrie de canvis moleculars, així com la participació
de factors quimiotàctics i cèl·lules estromals, com els macròfags (Zijlstra et al., 2008).
A més, es veu facilitat per la vasculatura aberrant que es forma dins el tumor (Multhoff
et al., 2014).
3) Supervivència a la circulació. Un cop al torrent circulatori, les cèl·lules tumorals
han de sobreviure en un microambient hostil. Primer, en perdre el substrat sobre el
qual adherir-se, les cèl·lules tumorals circulants (CTC) poden entrar en apoptosi
(anoikis) (Kim et al., 2012). Segon, les CTC es troben sotmeses a forces de cisalla
induïda per la velocitat de circulació (Barnes et al., 2012). I, tercer, dins el torrent
circulatori es troben multitud de cèl·lules immunitàries que les podrien destruir (Steinert
et al., 2014). Per sobreviure a l’anoikis, les cèl·lules tumorals modifiquen determinades
vies metabòliques, impedint l’entrada en apoptosi (Kim et al., 2012). A més, alguns
estudis han descrit que les CTC són capaces d’unir-se en circulació a les plaquetes
per tal de sobreviure a les forces de cisalla i escapar a l’atac del sistema immune (Gay
and Felding-Habermann, 2011). Amb tot, una petita proporció de cèl·lules tumorals
sobreviuen i són capaces d’extravasar.
4) Arrest en la microvasculatura i extravasació. Les observacions clíniques han
mostrat que els diferents tipus de càncer tenen preferència per metastatitzar en
determinats òrgans (tropisme) (Figura 7). Existeixen diverses teories al voltant
d’aquest fet. D’una banda, en la teoria de la llavor i el sòl (seed and soil) de l’any 1889,
Stephen Paget va proposar que existeixen uns marcadors específics en la vasculatura
de determinats òrgans que afavoreixen que les cèl·lules tumorals (les llavors)
extravasin en aquest entorn concret (el sòl) (Paget, 1889). D’altra banda, 30 anys més
tard, Ewing’s va postular que el tropisme metastàtic podia ser explicat pel patró de
circulació dins l’organisme i per l’arrest mecànic que pateixen les CTC en els primers
capil·lars que es troben (Ewing, 1928). És probable que el mecanisme real pel qual les
CTC tenen tropisme per determinats òrgans sigui una combinació d’ambdues
hipòtesis, de manera que les cèl·lules es detinguin en determinats òrgans
16
Introducció
mecànicament i/o per senyals químics específics i després requereixin un
microambient concret per poder extravasar i iniciar el creixement del tumor secundari
(Chu and Allan, 2012).
Figura 7. Tropisme metastàtic d’alguns dels principal s carcinome s.
Imatge obtinguda de (Valastyan and Weinberg, 2011).
Un cop les cèl·lules tumorals s’han aturat a la microvasculatura de l’òrgan diana,
poden iniciar el seu creixement al lumen del vas o bé extravasar (Valastyan and
Weinberg, 2011). Al contrari que en la intravasació, les cèl·lules tumorals no compten
amb el suport dels macròfags per travessar la paret vascular cap a dins del teixit (Strell
and Entschladen, 2008). A més, els vasos en l’òrgan de metàstasis són funcionals, fet
pel qual el pas a través d’ells és més difícil (Pantel and Brakenhoff, 2004). En funció de
l’òrgan al qual la cèl·lula tumoral pretengui accedir, es requeriran unes característiques
concretes per superar els obstacles particulars d’aquell microentorn (Nguyen et al.,
2009). Per exemple, per travessar la barrera hematoencefàlica i arribar al teixit
cerebral es requereixen unes particularitats diferents que per colonitzar el pulmó o el
teixit ossi (Luis-Ravelo et al., 2013; Seoane and De Mattos-Arruda, 2014). Per tal de
travessar les barreres físiques, la cèl·lula tumoral pot secretar factors com
l’angiopoietina-like-4, el VEGF, el COX-2 o les metal·loproteïnases que afavoreixin la
17
permeabilitat dels vasos (Huang et al., 2009; Weis et al., 2004). En connexió amb
aquest fet, nombrosos estudis han suggerit que el propi tumor primari envia senyals
als llocs secundaris de metàstasi per preparar l’entorn abans que arribin les CTC
(preparació del nínxol premetastàtic).
5) Establiment a l’òrgan secundari i colonització metastàtica. Encara que les
cèl·lules tumorals aconsegueixin extravasar a l’òrgan de metàstasi, la seva
supervivència no està assegurada, ja que han de sobreviure en un entorn estrany on
es troben exposades a l’acció de les cèl·lules immunes citotòxiques (Slaney et al.,
2013). Aquest nou entorn es diferencia de l’òrgan d’origen en la composició de la
ECM, en els factors de creixement i les citoquines disponibles, en les cèl·lules
estromals i inclús en la seva microarquitectura (Quail and Joyce, 2013). En aquest
context, les cèl·lules tumorals poden entrar en un estat de latència, formant masses
avasculars de menys de 2 mm (micrometàstasis dorments) que poden persistir a
l’organisme durant anys sense ser detectades (Wells et al., 2013). A més d’escapar a
la immunovigilància, les cèl·lules tumorals necessiten sobreposar-se a l’arrest del cicle
cel·lular i a la falta de nutrients per iniciar la colonització metastàtica (Shibue and
Weinberg, 2011). L’activació de l’angiogènesi (angiogenic switch) determina la
transició entre l’estat de latència i la formació de macrometàstasis, amb una elevada
proliferació tumoral (Moserle et al., 2009). En aquest procés tornen a cobrar una gran
importància les cèl·lules infiltrades com els macròfags, i la secreció de multitud de
factors que reeduquen el microentorn per tal que sigui més favorable per al creixement
de les macrometàstasis (Quail and Joyce, 2013).
Tenint en compte la multitud d’obstacles que les cèl·lules tumorals han de superar des
que adquireixen la capacitat invasiva fins que formen les macrometàstasis, no és d’estranyar
la poca eficiència del procés. En concret, tot i que la detecció de CTC és relativament
freqüent en la majoria de carcinomes (Miller et al., 2010), s’ha estimat que només un 0.01%
de les cèl·lules tumorals que entren a la circulació són capaces de desenvolupar metàstasis
macroscòpiques (Zhe et al., 2011). Aquest fet indica que alguna de les etapes finals de la
cascada metastàtica és superada molt rarament.
1.2.2.1.
El nínxol premetastàtic
Com s’ha explicat anteriorment, l’adaptació al nou microentorn per part de la cèl·lula
tumoral extravasada és un procés difícil. Alguns estudis han proposat que aquest obstacle
18
Introducció
pot ser superat mitjançant l’establiment d’un nínxol premetastàtic per part del tumor primari,
abans de l’arribada de les CTC (Psaila and Lyden, 2009).
Segons està descrit, el tumor primari allibera determinats senyals a nivell sistèmic,
com el SDF-1 (de l’anglès Stromal Cell-Derived Factor-1), TNFα (de l’anglès Tumor Necrosis
Factor), TGFβ, LOX (lisil oxidasa), VEGF-A o PlGF (Peinado et al., 2011; Perryman and
Erler, 2014), que estimula els fibroblasts residents a l’òrgan diana a sobreregular
determinades molècules de la matriu, com la fibronectina. Aquest fet, permet la mobilització
de cèl·lules progenitores hematopoètiques derivades de la medul·la òssia (BMDC) positives
pel receptor de VEGFR1, via la interacció de molècules d’adhesió com el VLA-4 (de l’anglès
Very Late Antigen-4 o integrina α4β1) amb la fibronectina (Kaplan et al., 2005). Les BMDC
modifiquen el microentorn, secretant factors proinflamatoris com S100A8, S100A9 i SAA-3
(de l’anglès Serum Amyloid A-3) i enzims proteolítics com la MMP-2 i MMP-9, que estimulen
determinades integrines i, a més, alliberen factors segrestats a la matriu (Chang and Erler,
2014). Amb tot, el microentorn es predisposa per l’eventual arribada de les cèl·lules tumorals
des del tumor primari, facilitant-ne la implantació i la colonització metastàtica.
1.2.3. Inflamació protumoral
La presència de leucòcits dins de la massa tumoral va ser reportada per primer cop a
mitjans del segle XIX per Rudolf Virchow, donant lloc a la primera evidència que relacionava
el càncer i la inflamació (Virchow, 1863).
En la darrera dècada, s’ha fet evident la gran importància del paper que juga el
sistema immune en la progressió del càncer. De fet, com s’ha dit anteriorment, Hanahan i
Weinberg van incloure en la revisió dels Hallmarks of cancer publicada el 2011 dues noves
característiques relacionades amb les cèl·lules inflamatòries.
El sistema immunitari juga un paper dual en la progressió tumoral. D’una banda, la
teoria de la immunovigilància proposa que els teixits estan contínuament monitoritzats per
les cèl·lules immunes per eradicar qualsevol possible aparició de tumors primaris o
metàstasis, per la qual cosa les cèl·lules tumorals han de desenvolupar mecanismes per
evadir aquest atac (Fruci et al., 2013). D’altra banda, cada cop hi ha més evidències que la
inflamació intratumoral pot tenir un efecte inductor de la tumorogènesi i la progressió, no
només durant el creixement del tumor primari, si no també participant en diferents etapes de
la cascada metastàtica, com l’extravasació, la intravasació, l’establiment del nínxol
premetastàtic i la colonització metastàtica (Smith and Kang, 2013). En aquest sentit,
nombrosos estudis han mostrat que existeix una relació directa entre la inflamació crònica i
19
el càncer. Per exemple, fins a un 20% dels casos de càncer estan lligats a infeccions
cròniques, un 30% poden ser atribuïts al tabac o a la inhalació de contam inants (com el
sílice i l’asbest) i un 35% són causats per factors dietètics (20% lligats a la obesitat)
(Aggarwal et al., 2009).
El microentorn tumoral conté cèl·lules de la immunitat innata (macròfags, neutròfils,
mastòcits, cèl·lules mieloides o MDSC, cèl·lules dendrítiques i cèl·lules NK (de l’anglès
Natural Killer)), així com cèl·lules de la immunitat adaptativa (limfòcits T i B) (Smith and
Kang, 2013). Aquesta gran diversitat de cèl·lules es comuniquen entre elles i amb la resta de
components de l’estroma mitjançant citoquines i factors solubles que actuen de manera
autocrina o paracrina per controlar el creixement del tumor (Zamarron and Chen, 2011). El
patró d’expressió creat en el microentorn, a través de l’activació de factors de transcripció
com NFκB, AP-1, STAT o SMAD, determinarà si s’afavoreix la immunitat antitumoral (IL-12,
TRAIL, IFNγ) o bé la progressió del tumor (IL-6, IL-17, IL-23, etc.), podent afectar alhora el
creixement i la supervivència de les cèl·lules tumorals (TRAIL, FasL, TNFα, lligands de
EGFR, TGF-β, IL-6, etc.) (Zamarron and Chen, 2011). És aquesta xarxa de comunicació,
junt amb l’estat d’activació dels diferents tipus cel·lulars, la que determinarà el tipus de
resposta per part del sistema immune (protumoral o antitumoral). Està descrit que, en
tumors ja establerts, el balanç tendeix a promoure la progressió del tumor, mentre que en
estadis inicials és probable que l’equilibri es desplaci cap a l’eradicació de les cèl·lules
tumorals, fins que aquestes aconsegueixen adoptar els mecanismes per evadir-lo.
Durant la resposta antitumoral, les cèl·lules dendrítiques presenten antígens tumorals
als limfòcits. Després de l’activació, les cèl·lules T citotòxiques CD8+ eliminen les cèl·lules
tumorals directament, mentre que les CD4+ (T helper), estimulen les cèl·lules B (Efferson et
al., 2003). Els anticossos produïts indueixen la mort via l’activació del sistema del
complement (CDC) o de la citotoxicitat cel·lular mitjançada per anticossos (ADCC) (Doan et
al., 2012). Les citoquines característiques en aquesta resposta antitumoral són el IFNγ, el
TNFα, la IL-12, la IL-4, la IL-5, la IL-13, la IL-17 i la IL-22 (Chimal-Ramirez et al., 2013). Tot i
això, també s’han descrit funcions protumorals per a aquest tipus de cèl·lules immunes, com
els limfòcits T reguladors (Treg), que secreten citoquines immunosupressores com la IL-10 i
el TGFβ, induint l’arrest en el cicle dels limfòcits T citotòxics i bloquejant la maduració de les
cèl·lules dendrítiques, entre altres funcions (Nishikawa and Sakaguchi, 2010).
Els macròfags, per la seva banda, provenen dels monòcits que viatgen pel torrent
sanguini i s’infiltren dins de la massa tumoral en resposta a diferents citoquines (VEGF,
MCPs (de l’anglès Monocyte Chemotactic Protein), PDGF, M-CSF (de l’anglès Macrophage
Colony-Stimulating Factor, etc.) (Noy and Pollard, 2014) i són un dels principals actors dins
20
Introducció
el microentorn, amb una funció cabdal per al destí del tumor. Segons els senyals del
microentorn, els macròfags es poden polaritzar en dos subtipus cel·lulars (Chanmee et al.,
2014):
x
Macròfags
M1:
polarització
en
resposta
a
IFNγ,
estímuls
microbians
(lipopolisacàrid) o citoquines (TNFα, o CSF-2). Expressen alts nivells de citoquines
proinflamatòries (TNFα, IL-1, IL-6, IL-12 o IL-23), així com el complex major
d'histocompatibilitat (MHCII) i la sintasa induïble d'òxid nítric (iNOS). Són capaços
d’eliminar els agents patògens i iniciar la resposta immune antitumoral.
x
Macròfags M2: polarització en resposta a IL-4, IL-10 i IL-13. Tenen l’expressió de
MHCII i iNOS reduïda, així com la de IL-12 i la IL-23, mentre que expressen
elevats nivells de IL-10, IL-6, TNFα, arginasa-1 i el receptor de manosa CD206.
Aquest fenotip cel·lular té la capacitat de promoure l’angiogènesi i la remodelació
tissular, complint una funció protumoral.
Tot i aquesta classificació simplista, els mecanismes cel·lulars i moleculars que
regulen positivament i negativament la funció i el fenotip dels TAM segueixen sent en gran
mesura desconeguts. En realitat, es pensa que els fenotips M1 i M2 representen els extrems
d’un ampli espectre d’estats funcionals que els macròfags poden presentar en funció del seu
entorn (Sica and Mantovani, 2012). Així doncs, sovint, alguns marcadors i la secreció
d’algunes citoquines es poden trobar tant en macròfags protumorals com en macròfags
antitumorals. A més, s’han descrit papers protumorals per a algunes citoquines típicament
secretades per macròfags M1 (com el TNFα o CSF-2) (Balkwill, 2006; Gutschalk et al.,
2013), així com funcions antitumorals per citoquines secretades per macròfags M2 (com la
IL-10) (Fujii et al., 2001). Per tant, el que determina en darrer terme l’efecte d’aquestes
cèl·lules sobre la progressió del tumor serà el conjunt de senyals que secreten al seu entorn.
Un cas similar al dels macròfags es dóna en els neutròfils, on també existeix una
polarització cap a un fenotip protumoral (N2) o antitumoral (N1), en funció de les citoquines
presents en el microentorn, un canvi regulat principalment pel TGFβ (Fridlender et al., 2009).
Per tant, les cèl·lules immunes infiltrades al tumor tenen un paper preponderant en
l’evolució de la malaltia, secretant una gran diversitat de citoquines i factors que, en conjunt,
poden afavorir la proliferació i la supervivència de la cèl·lula tumoral, la formació de vasos i
la metàstasi. No és d’estranyar, doncs, que algunes estratègies terapèutiques s’hagin dirigit
a controlar les cèl·lules immunes o els factors secretats per elles.
21
1.3. Família de les proteïnes S100
Com s’ha explicat anteriorment, el càncer és una malaltia en la qual participen
diferents tipus cel·lulars que interactuen entre ells mitjançant la secreció de multitud de
factors a l’espai extracel·lular, entre altres mecanismes. Entre aquests factors, estan
guanyant cada cop més protagonisme la família de proteïnes petites d’unió a calci, S100.
Les proteïnes S100, anomenades així per la seva solubilitat en 100% de sulfat
d’amoni, només estan presents en els vertebrats, mostrant un patró d’expressió específic del
tipus cel·lular (Marenholz et al., 2004). Dels 25 membres que componen la família, 21 tenen
el seu gen localitzat a la regió cromosòmica 1q21, i 14 d’ells es troben localitzats al complex
de diferenciació epidèrmica, una regió freqüentment alterada durant el càncer (Tyszkiewicz
et al., 2014). Els altres membres es troben al loci 4p16 (S100P), 5q14 (S100Z), 21q22
(S100B) i Xp22 (S100G) (Santamaria-Kisiel et al., 2006). Les S100 no tenen activitat
enzimàtica intrínseca, però s’han descrit multitud de funcions intracel·lulars i extracel·lulars
que demostren en molts casos la seva associació amb la progressió de diferents malalties.
Alliberades al microentorn tumoral, les S100 poden participar en el diàleg entre les cèl·lules
com ho fan les citoquines i els factors de creixement. A més, per les seves particularitats,
alguns membres de la família han sigut considerats com a potencials biom arcadors i també
com a possibles dianes terapèutiques.
1.3.1. Estructura
Les proteïnes de la fam ília de les S100 són proteïnes petites de baix pes molecular (913 KDa). La seva característica estructural principal és que presenten dos llocs d’unió a calci
del tipus EF-hand de 12 aminoàcids (hèlix-loop-hèlix), un dels quals, localitzat a la regió Nterminal de la proteïna, és poc convencional (pseudo EF-hand), de manera que té una
menor afinitat pel calci, mentre que l’altre, localitzat a la regió C-terminal, és canònic
(Heizmann et al., 2002). Aquests dos dominis es troben connectats per una regió frontissa
(hinge). A més, a la part C-terminal, després de la quarta hèlix, hi ha una extensió de pocs
aminoàcids amb elevada mobilitat (Figura 8A).
Les majors diferències entre les proteïnes de fam ília de les S100 es troben en la
longitud i la seqüència de la regió frontissa i de l’extrem C-terminal, donant lloc a les
particularitats funcionals de cadascun dels membres (Figura 8B) (Gross et al., 2014).
22
Introducció
Figura 8. Estructura secundaria i homologia de les proteïnes S100.
A) Estructura secundaria comú a tots els membres de la família de les S100.
B) Homologia a nivell de seqüència proteica. Imatges obtingudes de (Rohde et al., 2010)
i (Gross et al., 2014).
Una de les característiques estructurals més rellevants de les S100 és que formen
homodímers o heterodímers (per exemple S100A8/S100A9) antiparal·lels per unions no
covalents (Figura 9A) i és en aquest estat que exerceixen la seva funció via la interacció
amb altres proteïnes (Heizmann et al., 2002), excepte en el cas de la S100G que funciona
com a monòmer (Skelton et al., 1994). Alguns membres, a més, poden formar tetràmers,
hexàmers o oligòmers més grans, com la S100B, la S100A4, la S100A8/A9 i la S100A12
(Kizawa et al., 2013; Thulin et al., 2011). En alguns casos, la unió del calci als dominis EFhand indueix un canvi conformacional en el dímer, que permet l’exposició de les regions
hidrofòbiques amb les que la proteïna interactua amb el seu entorn (Figura 9B) (Baudier
and Gerard, 1986). Tot i això, altres membres, com la S100A10, no tenen un domini d’unió a
calci funcional, fet pel qual la seva interacció amb altres proteïnes és independent del catió
(Santamaria-Kisiel et al., 2006).
23
A
B
Figura 9. Estructura tridimensional de les S100.
A) Estructura tridimensional del dímer de S100. B) Canvi conformacional induït per la
unió del calci. Imatge modificada de (S rikrishna and Freeze, 2011).
A més del calci, altres membres de la família són capaços d’unir també zinc o coure,
ajudant també a la seva estabilitat estructural i a la unió amb altres proteïnes diana (HaaseKohn et al., 2011; Moroz et al., 2011).
1.3.2. Expressió
Les proteïnes S100 es poden trobar localitzades al citoplasma cel·lular i, en alguns
casos, a l’interior del nucli (Flatmark et al., 2003; Mandinova et al., 1998). A més, s’ha descrit
que alguns membres poden ser secretats a l’espai extracel·lular per mecanismes que
encara romanen per determinar (Leclerc et al., 2009).
En condicions normals, les S100 es troben expressades en multitud de teixits, sobretot
en el sistema nerviós central (S100A13, S100B i S100P), en cèl·lules del sistema immune
(S100A4, S100A8, S100A9, S100A12, S100A16 i S100P), a la pell (S100A7 i S100A15), o
en cèl·lules epitelials del sistema respiratori (S100A2, S100A4 i S100A14), del sistema
urogenital (S100A2, S100A4, S100A7, S100A8, S100A9, S100A14 i S100A16) o del sistema
gastrointestinal (S100A14, S100A16, S100G i S100P). En canvi, altres membres de la
24
Introducció
família presenten una expressió generalitzada en la majoria dels teixits (S100A1, S100A3,
S100A6, S100A10, S100A11 i S100Z) (Cross et al., 2005; Yao et al., 2007b; Zhu et al.,
2013).
D’altra banda, en condicions patològiques, s’han trobat sobreexpressades en multitud
de processos, principalment relacionats amb la inflamació tissular, com, per exemple, la
psoriasis (S100A4, S100A7, S100A8/A9, S100A10, S100A12 i S100A15) (Anderson et al.,
2009; Benoit et al., 2006; Hegyi et al., 2012), el dany cerebral (S100B i S100A5) (Zongo et
al., 2012), les cardiomiopaties (S100A1, S100A4 i S100B) (Wang and Wang, 2010), la fibrosi
cística (S100A8/A9) (Renaud et al., 1994), l’esclerosi lateral amiotròfica (S100B) (Sussmuth
et al., 2003), l’artritis reumatoide (S100A1, S100A2, S100A4, S1008, S100A9, S100A11, i
S100B) (Yammani, 2012) o l’alzheimer (S100A7 i S100B) (Qin et al., 2009; Sheng et al.,
1996).
A més, s’ha vist que l’expressió de molts membres de la fam ília es pot veure induïda o
incrementada en tumors de diferents orígens, tal com es mostra a la Taula 1, correlacionant,
en molts casos, amb un mal pronòstic per al pacient (Hu et al., 2014; Kaur et al., 2014; Liu et
al., 2014; Wang et al., 2012; Wang et al., 2010b; Xiao et al., 2012; Yao et al., 2007a).
Taula 1. Expressió de les proteïnes S100 en diferents tipus de càncer.
Càncer
Pulmó
Mama
Colorectal
Pròstata
Proteïnes S100 sobreexpressades
S100A1, S100A2, S100A3, S100A4, S100A6, S100A7, S100A8/S100A9,
S100A10, S100A11, S100A14, S100A15, S100B, S100P
S100A1, S100A2, S100A4, S100A6, S100A7, S100A8/S100A9, S100A10,
S100A11, S100A14, S100P, S100B
S100A4, S100A6, S100A8/S100A9, S100A10, S100A11, S100A14, S100B,
S100P
S100A2, S100A4, S100A7, S100A8/S100A9, S100A10, S100A11, S100B,
S100P
Gàstric
S100A2, S100A4, S100A6, S100A8/S100A9, S100A11, S100P
Buf eta
S100A4, S100A7, S100A8/S100A9, S100A11, S100P
Pàncrees
S100A2, S100A4, S100A6, S100A8/S100A9, S100A10, S100A11, S100P
Renal
S100A1, S100A2, S100A4, S100A11
Cap i coll
S100A4, S100A7, S100A11, S100A14
Melanoma
S100A2, S100A4, S100A6, S100A13, S100B, S100P
25
1.3.3. Funció
En condicions fisiològiques, s’ha descrit que les proteïnes S100 exerceixen funcions
intracel·lulars relacionades amb l’homeòstasi del calci, i que regulen processos com el
moviment cel·lular, la proliferació o la diferenciació, mitjançant la interacció amb proteïnes
del citosquelet i amb factors de transcripció, entre d’altres (Donato et al., 2013).
Tot i la similitud en estructura i seqüència que existeix entre els diferents membres, les
seves funcions són particulars per a cada S100, depenent de les proteïnes amb les que
interaccionen i els tipus cel·lulars que les expressen (Chen et al., 2014a).
Les proteïnes S100 poden ser secretades a l’espai extracel·lular on exerceixen la seva
funció de manera autocrina o paracrina a través de receptors de membrana. El receptor més
descrit és RAGE (de l’anglès Receptor for Advanced Glycation End-products), un receptor
de la família de les immunoglobulines amb tres dominis extracel·lulars d’interacció i una
petita cua intracel·lular que li serveix per activar les vies de senyalització en resposta al
lligand (Ott et al., 2014). A banda de les proteïnes S100, entre els seus possibles lligands es
troben els AGEs (de l’anglès Advanced Glycation End-product), els pèptids β-amiloides,
l’amfoterina, també anomenada HMGB1 (de l’anglès High Mobility Group Box 1), i algunes
integrines (Xie et al., 2013). La interacció del lligand amb RAGE, indueix la dimerització del
receptor, permetent així la transducció del senyal cap a l’interior de la cèl·lula (Yatime and
Andersen, 2013).
D’altra banda, algunes S100 poden interaccionar amb altres receptors de membrana a
més de RAGE, com per exemple el TLR4 o el CD36 (de la família dels receptors scavenger)
(Figura 10).
Figura 10. Receptors implicats en la resposta cel·lular a les proteïnes S100.
Imatge obtinguda de (Donato et al., 2013).
26
Introducció
S’ha descrit que, a través de l’activació dels seus receptors, poden induir l’expressió
de diferents citoquines i factors de creixement, com per exemple el TNFα, la MMP9, la
MMP13, la MMP2, la VCAM-1 (de l’anglès Vascular Cell Adhesion Molecule 1), la IL8, la
ICAM-1 (de l’anglès Intercellular Adhesion Molecule 1), la MCP-1, el PAI-1 (de l’anglès
Plasminogen Activator Inhibibor-1), el tPA (de l’anglès tissue Plasminogen Activator), el
VEGF i les pròpies S100 (Chen et al., 2014a).
1.3.3.1.
Les proteïnes S100 en el desenvolupament tumoral
Com s’ha dit anteriorment, alguns membres de la família són sobreexpressats en
determinats tipus de càncer. En aquestes condicions patològiques, exerceixen multitud de
funcions relacionades amb la cèl·lula tumoral o amb la resta de components de l’estroma,
participant directa o indirectament en la progressió de la malaltia (Figura 11).
Figura 11. Implicació de les S100 en diferents etapes de la progressió tumoral.
Imatge obtinguda de (Chen et al., 2014a).
Diferenciació cel·lular
En alguns casos, l’expressió de la proteïna S100 correlaciona amb el nivell de
diferenciació del tumor. Per exemple, la S100A11 està associada a la diferenciació de
l’adenocarcinoma de pàncrees (PAC) (Xiao et al., 2012). Mentre que, en altres casos, la
seva expressió va lligada a la desdiferenciació de les cèl·lules tumorals, com en el cas de la
S100A4 en PAC o en carcinoma escamós d’esòfag (ESCC) (Rosty et al., 2002) o la S100A6
27
en carcinoma hepatocel·lular (HCC) (Hua et al., 2011). Altres membres, com la S100A2 i
l’heterodímer S100A8/S100A9 també han estat relacionats amb la desdiferenciació cel·lular
en carcinoma pancreàtic (Ohuchida et al., 2007) o d’esòfag (Kong et al., 2004),
respectivament.
Cicle cel·lular i proliferació
La desregulació del cicle cel·lular permet a la cèl·lula tumoral mantenir una proliferació
sostinguda. Els mecanismes pels quals aquestes proteïnes influeixen sobre el cicle cel·lular
són diversos. Per exemple, s’ha descrit que la interacció de les S100 (S100A1, S100A4,
S100A6, S100A7, S100A8/A9, S100A11, S100A12, S100A14, S100B i S100P) amb RAGE
pot induir l’activació de la via de les MAPK i del factor de transcripció NFkB (Xie et al., 2013).
A més, alguns membres de la família (S100A2, S100A4, S100A7 i S100A14) estan
involucrats en la regulació de la senyalització depenent de l’EGF, incrementant el seu efecte
(Hernan et al., 2003; Paruchuri et al., 2008). Pel que fa a la seva funció intracel·lular,
algunes S100 poden intervenir, per exemple, en la regulació de la funció de p53 ja sigui per
la participació en la seva via (S100A9) (Li et al., 2009) o per una interacció directa amb la
proteïna (S100A1, S100A2, S100A4, S100A6 i S100B) (van Dieck et al., 2009).
Alguns estudis han demostrat que la sobreexpressió d’algunes S100 va acompanyada
d’un augment de la velocitat de creixement del tumor (S100A2 (van Dieck et al., 2009),
S100A4 (Hernandez et al., 2013), S100A6 (Duan et al., 2014), S100A7 (Nasser et al., 2012),
S100P (Basu et al., 2008), etc.), mentre que la seva supressió, inhibeix la progressió de la
malaltia (S100A4 (Hernandez et al., 2013), S100A7 (Paruchuri et al., 2008), S100A8/A9
(Ichikawa et al., 2011), S100P (Arumugam et al., 2012), etc.).
Apoptosi
Cada cop hi ha més evidències que relacionen les proteïnes S100 i la regulació de
l’apoptosi. En alguns casos, l’eliminació de la proteïna pot induir l’entrada en apoptosi, com
és el cas de la S100A4 en cèl·lules de càncer de pàncrees (Mahon et al., 2007), mentre que
alguns estudis in vitro han mostrat que la pròpia S100 pot induir la mort cel·lular sota
determinades condicions, com pot ser una elevada concentració de proteïna (S100A6,
S100A14, S100A8/A9, S100B) (Jin et al., 2011; Sorci et al., 2004).
Moviment cel·lular i metàstasi
Aquestes proteïnes S100 han estat relacionades amb diferents etapes de la cascada
metastàtica i, fins i tot, alguns membres, com la S100A4, són considerats marcadors de
metàstasi (Boye and Maelandsmo, 2010). En particular, la S100A4 (també anomenada
28
Introducció
metastatina) promou la transició epiteli-mesènquima, la invasió i el moviment cel·lular quan
es troba sobreexpressada en cèl·lules de càncer de pàncrees (Jenkinson et al., 2004). A
més, la seva supressió redueix la capacitat metastàtica en cèl·lules d’osteosarcoma (Zhang
et al., 2011a). A nivell extracel·lular, la S100A4 promou l’expressió de metal·loproteïnases
de la matriu i altres gens relacionats amb el moviment cel·lular (Bjornland et al., 1999). Altres
membres implicats en processos de metàstasi són la S100A2, la S100A6, la S100A7, la
S100A8/A9, la S100A10, la S100A14 i la S100P, en molts casos, actuant extracel·lularment
via la interacció amb el receptor RAGE (Bulk et al., 2009; Kwon et al., 2013; Nedjadi et al.,
2009; Ye et al., 2013).
Microentorn tumoral i angiogènesi
A banda d’actuar directament sobre la cèl·lula tumoral les proteïnes S100 també han
estat relacionades amb la comunicació que s’estableix entre les cèl·lules malignes i la resta
de tipus cel·lulars que componen l’estroma del tumor. Per exemple, s’ha descrit la seva
implicació en la interacció entre les cèl·lules tumorals i els fibroblasts, la infiltració de
leucòcits, el reclutament de macròfags, neutròfils i cèl·lules mieloides derivades de medul·la
òssia i en la regulació de l’angiogènesi (Chen et al., 2014a).
Un dels membres de la família més estudiat en aquest sentit és la S100A4. De fet,
aquesta proteïna és considerada com un marcador de l’activació de fibroblasts associats al
tumor i dels macròfags protumorals (M2) (Osterreicher et al., 2011). S’ha descrit que les
cèl·lules tumorals poden induir l’alliberament de S100A4 per part de les cèl·lules de
l’estroma, afavorint la secreció d’altres factors, com per exemple la MMP13, el RANTES, la
tenascina-C o el VEGF-A, que contribuiran a la progressió de la malaltia (Forst et al., 2010;
Schmidt-Hansen et al., 2004). De la mateixa manera, l’heterodímer S100A8/A9 ha estat
també relacionat amb la resposta inflamatòria protumoral, actuant com a quimioatraient de
diferents tipus de cèl·lules immunes (Ryckman et al., 2003). Per últim, les proteïnes S100A7
i S100A10 també han mostrat un paper proinflamatori, participant en la secreció de diferents
citoquines i en el reclutament de macròfags dins el tumor (Mandal et al., 2007; Phipps et al.,
2011).
A més de promoure la inflamació protumoral, les proteïnes S100 afavoreixen la
progressió de la malaltia estimulant la formació d’una xarxa vascular que suporti el seu
creixement. Per exemple, alguns membres de la família (S100A4, S100A7, S100A10 i
S100A13) indueixen la secreció de factors proangiogènics com les MMP, el TGFβ, el bFGF
o el VEGF (Ambartsumian et al., 2001). En el cas concret de la proteïna S100A4, s’ha
descrit que pot induir la secreció de MMP13 i MMP9 per part de les cèl·lules endotelials, així
29
com la seva mobilitat, mostrant un efecte sinèrgic en combinació amb el VEGF (Hernandez
et al., 2013).
1.3.4. Les S100 com a biomarcadors
Alguns estudis han mostrat que l’expressió tumoral d’alguns membres de la família és
un marcador de mal pronòstic en determinats tipus de càncer, com per exemple la S100A4
en càncer de pàncrees (Oida et al., 2006) o en càncer colorectal (Wang et al., 2010a).
A més, la presència en biofluids d’algunes S100 s’ha considerat com a possible
biomarcador de diagnòstic. La proteïna de la família més referenciada en aquest sentit és la
S100B, que es troba elevada en el sèrum de pacients amb melanoma o amb càncer de
mama, correlacionant els seus nivells amb un mal pronòstic per al pacient (Astrand et al.,
2013). Un altre exemple és la presència de la S100A6 en sèrum, que correlaciona amb
l’estadiatge del càncer gàstric (Zhang et al., 2014). La S100A7, per la seva banda, també ha
estat detectada al sèrum de pacients amb càncer de pulmó (Zhang et al., 2008) i a l'orina de
pacients amb càncer de bufeta (Celis et al., 1996; Ostergaard et al., 1999), mentre que les
proteïnes S100A8/S100A9 es troben augmentades al sèrum de pacients amb càncer
colorectal (Kim et al., 2009), entre altres indicacions.
1.3.5. Aproximacions terapèutiques relacionades amb les S100
A causa del paper determinant que les proteïnes S100 juguen en el desenvolupament
tumoral i la seva relació amb la progressió de la malaltia, molts estudis les han proposat com
a possibles dianes terapèutiques per al tractament del càncer i d’altres malalties
inflamatòries.
Una de les aproximacions per bloquejar la seva funció és l’ús de molècules petites. Per
exemple, la molècula antial·lèrgica cromolina inhibeix la unió de la proteïna S100P amb el
seu receptor RAGE, reduint el creixement de tumors pancreàtics en models animals
(Arumugam et al., 2006). Un fet a tenir en compte en aquest tipus d’aproximació és
l’especificitat de la molècula química, ja que, a causa de la gran similitud que existeix entre
els diferents membres de la família a nivell estructural, és probable que una molècula afecti
varies S100. De fet, s’ha vist que la cromolina també pot interaccionar amb la S100A12 i la
S100A13 (Okada et al., 2002). D’altra banda, també s’han descrit inhibidors químics de la
interacció de S100A10 i annexina A2 amb efectes antiangiogènics i antimetastàtics (Reddy
et al., 2011). Pel que fa a la S100A4, s’han estudiat diferents aproximacions amb molècules
químiques (per exemple, trifluoperazina o proclorperazina) que bloquegen la seva unió a la
30
Introducció
miosina IIA (Malashkevich et al., 2010). Altres estudis han proposat una sèries de potencials
inhibidors de la S100B (anomenats SBiXs) per al tractament de melanomes, astrocitomes,
tumors renals i alguns casos de leucèmies on la S100B es troba elevada (Cavalier et al.,
2014). Per últim, la molècula que es troba més avançada en fases clíniques actualment és el
Tasquinimod (Active Biotech i Ipsen), una molècula química que bloqueja la unió de la
proteïna S100A9 amb els seus receptors RAGE i TLR4 (Raymond et al., 2014) i que està
sent testada en Fase III per al tractament del càncer metastàtic de pròstata resistent a la
castració (mCRPC) (Armstrong et al., 2014) i en Fase II per al càncer hepatocel·lular
metastàtic, el càncer d’ovari, el càncer renal i el càncer gàstric (Active, 2014).
Altres aproximacions terapèutiques explorades per inhibir la funció de les S100 han
estat basades a reduir l’origen de la seva expressió (per exemple amb el tractament amb
inhibidors del creixement cel·lular, la teràpia gènica o amb l’ús de siRNA).
Recentment, s’han publicat tres estudis on es proposa l’ús d’anticossos monoclonals
específics (mAbs) per bloquejar la funció extracel·lular de la S100A4 o la S100P i que
podrien tenir importants aplicacions en el tractament del càncer de pàncrees (Dakhel et al.,
2014; Hernandez et al., 2013) i de mama (Klingelhofer et al., 2012). Mitjançant aquesta
aproximació terapèutica es va aconseguir reduir el creixement dels tumors primaris i la seva
capacitat metastàtica, demostrant que el bloqueig extracel·lular de les proteïnes S100 és
una bona estratègia per afectar el desenvolupament tumoral.
D’altra banda, també s’han utilitzant inhibidors de les proteïnes S100 com a possible
tractament de malalties inflamatòries. Per exemple, la inhibició de S100A4 amb un anticòs
policlonal va reduir els símptomes de psoriasi en un model animal (Zibert et al., 2010) i el
bloqueig de la S100A9 amb un anticòs monoclonal va demostrat ser efectiu en models
preclínics de la malaltia de Crohn i d’artritis (InflammatoRX, 2014).
1.4. La proteïna S100A7
La proteïna S100A7, també anomenada psoriasina, PSOR1 o S100A7c, va ser
descrita per primer cop com una proteïna sobreexpressada a la pell hiperplàsica de malalts
de psoriasi, caracteritzada per una diferenciació epidèrmica anormal i una elevada
inflamació (Madsen et al., 1991).
A nivell de seqüència, la proteïna S100A7 és el membre més divergent dins de la
família de les proteïnes S100, amb l’excepció de la S100A15 (també anomenada S100A7a),
amb la qual guarda una homologia del 93% (Wolf et al., 2003). S’han descrit ortòlegs per a
31
aquesta proteïna en altres espècies com ovella, vaca i cavall (Leeb et al., 2005; Virtanen,
2006). La seva forma murina, anomenada mS100a7a15, tan sols guarda un 32%
d’homologia amb la forma humana, però té unes característiques funcionals i d’expressió
equivalents, com són la localització cromosòmica, la conservació de dominis d’unió a Jab1 i
el patró d’expressió en diferents teixits (Webb et al., 2005; Wolf et al., 2006).
Pel que fa a la seva estructura, la S100A7 forma homodímers, amb un ió de Ca2+ unit
al domini EF-hand canònic de cada monòmer, i dos ions de Zn2+ localitzats a la interfície del
dímer (Brodersen et al., 1999). La proteïna uneix calci amb una elevada afinitat, provocant
un petit canvi estructural i ajudant a la seva estabilitat. A més, la unió del zinc permet la
formació del dímer i és important tant per la seva estructura tridimensional com per la
interacció amb altres proteïnes diana, com és el cas del receptor RAGE (Brodersen et al.,
1999; Heizmann and Cox, 1998).
1.4.1. Expressió i pronòstic
Com la resta de membres de la família, la S100A7 es pot trobar localitzada en el
citoplasma i en el nucli de les cèl·lules, així com ser secretada a l’espai extracel·lular
(Watson et al., 1998). De fet, s’ha vist que la seva localització nuclear correlaciona amb un
mal pronòstic en el carcinoma de cap i coll (Tripathi et al., 2010).
Mentre que, en condicions normals, la seva expressió a la pell és baixa, la proteïna
S100A7 s’ha trobat sobreexpressada en multitud de patologies dèrmiques com la psoriasi, la
dermatitis atòpica, la malaltia de Darier, la micosis fungoide i en processos de reparació de
ferides (Eckert et al., 2004). Totes aquestes patologies es caracteritzen per una inflamació
del teixit i una alteració en la diferenciació de les cèl·lules epitelials, suggerint un important
paper de la proteïna en aquests processos. En queratinòcits, per exemple, la S100A7 es pot
veure sobreexpressada en resposta a l’estímul amb les citoquines IL-17 i IL-22 (Glaser et al.,
2009), donant una idea de la seva possible regulació en funció dels senyals del microentorn.
En càncer, la proteïna S100A7 es troba sobreexpressada en tumors de diferents
orígens com: càncer de pulmó (Hu et al., 2012), càncer de mama (Wolf et al., 2009), càncer
de pell (inclòs melanoma) (Brouard et al., 2002; Moubayed et al., 2007), càncer de bufeta
(Ostergaard et al., 1999), càncer de cap i coll (Tripathi et al., 2010), carcinoma escamós de
laringe (Tiveron et al., 2012), carcinoma oral escamós (Kesting et al., 2009), carcinoma de
cèl·lula escamosa d’esòfag (Ji et al., 2004), càncer gàstric (El-Rifai et al., 2002) i càncer
d’ovari (Piura and Piura, 2009).
32
Introducció
En el càncer de pulmó de cèl·lula no petita, l’expressió de S100A7 correlaciona amb la
metàstasi en cervell (Zhang et al., 2007).
Pel que fa al càncer de mama, la S100A7 es troba sobreexpressada en el carcinoma
ductal in situ (DCIS) i en hiperplàsies atípiques o benignes, mentre que es veu reduïda quan
el tumor es torna invasiu, suggerint que l’expressió de la proteïna està associada amb la
diferenciació de l’epiteli i amb les primeres etapes de la tumorogènesi (Emberley et al.,
2004). La persistència de S100A7 en el carcinoma de mama invasiu és un factor de mal
pronòstic per al pacient (Al-Haddad et al., 1999).
El càncer de mama es classifica en funció de l’expressió de tres receptors: el receptor
d’estrògens (ER), el receptor de progesterona (PgR) i el receptor del factor epidèrmic humà
(HER-2). El pitjor pronòstic és per als pacients amb absència d’expressió dels tres receptors
(triple negatiu) a causa de l’absència de tractaments efectius (Davis et al., 2014). S’ha vist
que, tant en el DCIS com en el carcinoma invasiu de mama, existeix una correlació entre la
presència de S100A7 i el fenotip triple negatiu (Al-Haddad et al., 1999; Emberley et al.,
2003b). A més, l’expressió de l’ER està regulada per la senyalització via l’EGFR, on la
proteïna S100A7 també hi juga un paper determinant, induint una major resposta a l’EGF
(Paruchuri et al., 2008).
Quant al seu valor com a biomarcador, la proteïna S100A7 s’ha trobat present a l’orina
de pacients amb càncer de bufeta (Celis et al., 1996; Ostergaard et al., 1999) i amb
melanoma (Brouard et al., 2002). A nivell plasmàtic s’han trobat nivells de S100A7
detectables en pacients de càncer de pulmó (Zhang et al., 2008). A més, al plasma de
pacients amb càncer d’ovari s’han trobat elevats nivells d’autoanticossos contra la proteïna
(Gagnon et al., 2008). Per últim, la proteïna S100A7 també s’ha trobat present al plasma de
pacients amb psoriasis (Anderson et al., 2009) i en el líquid cefaloraquidi de pacients amb
alzheimer (Qin et al., 2009).
1.4.2. Funció
A la pell, la proteïna S100A7 es troba localitzada al citoplasma de les cèl·lules
epidèrmiques (queratinòcits) i pot ser secretada actuant com a pèptid antimicrobià contra la
infecció de patògens (Hattori et al., 2014). A més, és un dels substrats de l’enzim unit a
membrana transglutaminasa, participant en la formació de l’estrat còrnic (Ruse et al., 2001).
A nivell intracel·lular, interacciona amb la proteïna E-FABP (de l’anglès Epidermal-type
Fatty Acid-binding Protein), una proteïna relacionada amb el transport de lípids a l’interior
cel·lular i que també es troba sobreexpressada en psoriasis (Dallaglio et al., 2013) i en
33
pacients amb melanoma (Brouard et al., 2002). Aquesta interacció ha estat descrita en
queratinòcits, sense que s’hagi pogut determinar la seva implicació en processos cel·lulars
(Hagens et al., 1999). A més, en cèl·lules de càncer de mama, s’ha descrit la interacció de la
S100A7 amb RanBPM (Emberley et al., 2002), una proteïna relacionada amb la regulació de
vies de senyalització mitjançant la formació de complexos multiproteïna (Puverel and
Tessarollo, 2013), sense que tampoc s’hagi pogut determinar la seva importància biològica.
D’altra banda, alguns estudis mostren que la S100A7 promou l’agressivitat del càncer de
mama mitjançant la unió a Jab1 (de l’anglès c-Jun Activation Domain Binding Protein-1),
estimulant l’activació d’Akt i NFkB (Emberley et al., 2005). Aquesta unió és important per a la
supervivència de la cèl·lula tumoral sota condicions d'estrès, com la desadhesió (Emberley
et al., 2005). Per últim, s’ha vist que la proteïna S100A7 es pot unir a la cua citoplasmàtica
de la integrina αvβ6, induint una major capacitat invasiva en cèl·lules de carcinoma oral
(Morgan et al., 2011).
Quan es troba secretada a l’espai extracel·lular, es troba implicada en el diàleg entre
les cèl·lules que componen la massa tumoral, actuant de manera autocrina i paracrina a
través del receptor RAGE (Donato et al., 2013). A nivell experimental, alguns estudis
apunten que la S100A7 pot estar implicada en la regulació de la infiltració de cèl·lules
immunes, com els limfòcits i els neutròfils (Jinquan et al., 1996; Wolf et al., 2008), actuant de
manera sinèrgica en combinació amb la proteïna S100A15 (Hegyi et al., 2012; Wolf et al.,
2008). A nivell de cèl·lula endotelial, indueix una major proliferació i estimula la secreció de
factors proangiogènics com el VEGF, també a través de la interacció amb RAGE (Shubbar
et al., 2012). A més, s’ha vist que aquesta interacció indueix l’activació NFkB, que controla la
transactivació de diferents gens implicats en la resposta immune (IL-1, IL-6, IL-8, TNFα), la
proliferació (ciclina D1) i l’apoptosi (Sparvero et al., 2009). Aquestes citoquines, junt amb la
presència de les cèl·lules immunes reclutades, afavoreixen la supervivència i la progressió
de les cèl·lules tumorals. Per últim, s’ha descrit que la interacció de la S100A7 amb RAGE
indueix la migració de cèl·lules d’osteosarcoma (Kataoka et al., 2012).
Alguns investigadors han estudiat l’efecte de la sobreexpressió i la subexpressió de la
proteïna sobre diferents processos cel·lulars. Per exemple, en cèl·lules de càncer de mama
triple negatiu amb expressió endògena de la proteïna (MDA-MB-468), es va veure que la
sobreexpressió de S100A7 induïa una major capacitat proliferativa i invasiva (Liu et al.,
2013). En canvi, un altre estudi va mostrar que la seva inhibició amb un shRNA en aquesta
mateixa línia cel·lular induïa una major capacitat proliferativa in vitro mentre que a nivell in
vivo les cèl·lules transfectades creixien a una velocitat molt menor, en comparació amb el
grup control (Krop et al., 2005). Els tumors que no expressaven S100A7 tenien una menor
vasculatura i una menor tinció del marcador de proliferació Ki67. Aquestes mateixes cèl·lules
34
Introducció
transfectades van mostrar, en un altre estudi, una menor capacitat de resposta al factor de
creixement EGF (Paruchuri et al., 2008). A més, quan es van implantar al fèmur de ratolins,
es va veure que les cèl·lules transfectades amb shRNA-S100A7 mostraven un menor
creixement i una reducció de les lesions osteolítiques, en comparació amb les cèl·lules amb
expressió endògena de S100A7. D’altra banda, es va veure que la sobreexpressió de la
proteïna S100A7 també en cèl·lules de càncer de mama triple negatiu (MDA-MB-231) induïa
una major expressió de VEGF i MMP-9 in vitro (Liu et al., 2013). A més, en concordança
amb els estudis previs, es va veure que les cèl·lules de càncer de mama triple negatiu amb
una expressió induïda de S100A7 tenien una major capacitat de resposta al factor EGF in
vitro i una major capacitat de colonització metastàtica, quan s’injectaven per via intravenosa
en ratolins, en comparació amb les cèl·lules que no expressaven la proteïna (Sneh et al.,
2013). En canvi, en cèl·lules de càncer de mama positives pel receptor d’estrògens, com la
MCF7 i la T47D, la capacitat de resposta a EGF es veia reduïda, quan s’induïa la expressió
de S100A7 (Sneh et al., 2013), suggerint així un paper diferencial en funció de les
característiques intrínseques de la cèl·lula.
La discordança en alguns casos entre l’efecte de l’expressió de la S100A7 in vitro i el
seu efecte a nivell in vivo fa pensar que la importància d’aquesta proteïna en el
desenvolupament tumoral es troba en el paper que juga sobre la resta de tipus cel·lulars que
conformen el microentorn del tumor. En relació a aquest fet, en un model de ratolí transgènic
que expressava de manera induïble la proteïna mS100a7a15 en cèl·lules de la glàndula
mamària, es va veure que, després del tractament amb doxiciclina, es produïa una
hiperplàsia de la mama, observant-se una elevada expressió de marcadors de proliferació i
un major reclutament de macròfags (Nasser et al., 2012). A més, quan s’injectaven cèl·lules
tumorals a la mama dels ratolins es veia un major creixement en aquells animals on s’havia
induït l’expressió de la S100A7, així com un major nombre de metàstasis pulmonars. En
analitzar tant els tumors com els pulmons d’aquests ratolins es va observar una major
expressió de gens prometastàtics i un major reclutament de macròfags de tipus M2,
confirmant-se la importància del seu paper extracel·lular en la progressió del tumor.
Aquest conjunt de dades suporten l’efecte protumoral que té la S100A7, actuant sobre
diferents tipus cel·lulars i afavorint processos com l’angiogènesi i la metàstasi. És necessari,
però, aprofundir en l'enteniment del paper de la proteïna en diferents processos i determinar
la seva funció en cadascun dels compartiments cel·lulars de manera integradora, per oferir
així una visió global de la seva importància en la progressió de la malaltia.
35
1.5. Biomarcadors tumorals
El diagnòstic del càncer i el grau de la malaltia es fa, principalment, en base a
observacions físiques, biòpsies de teixit i tests d’imatge (Hussain and Nguyen, 2014). Junt
amb aquestes anàlisis, l’ús de biomarcadors en la pràctica clínica és de gran utilitat per tres
motius (Cagle et al., 2013):
1. Valor diagnòstic: permet detectar la presència del tumor, sobretot en estadis
inicials quan encara no dóna símptomes (detecció precoç).
2. Valor pronòstic: permet predir l’agressivitat de la malaltia i la seva possible evolució
en absència de tractament.
3. Valor predictiu: permet avançar la resposta dels pacients a un determinat
tractament.
Segons l'Institut Nacional del Càncer dels Estats Units (NCI), un biomarcador és una
molècula que es troba en els fluids biològics o en els teixits, en presència de la malaltia
(NCI, 2014). Algunes estratègies preclíniques per al descobriment de nous biomarcadors
inclouen la genòmica, la proteòmica, la metabolòmica, l’anàlisi de microRNAs, l’anàlisi de
SNP (de l’anglès Single Nucleotide Polymorphism) i la seqüenciació de nova generació
(NGS), a partir de l’anàlisi de biòpsies de teixit fresc, en teixit parafinat (FFPE, de l’anglès
Formalin-Fixed Paraffin-Embeded) o en fluids biològics. Altres aproximacions de gran interès
són l’estudi de les cèl·lules tumorals circulants i l’anàlisi de marcadors específics de cèl·lules
mare tumorals o del DNA tumoral lliure circulant (ctDNA) (Figura 12) (Mabert et al., 2014).
Idealment, un biomarcador ha de ser detectable d’una manera fàcil, fiable, rendible i no
invasiva (o mínimament invasiva), amb una elevada especificitat analítica i sensibilitat
(Diamandis, 2012). Les millores en aquest camp, han permès la incorporació de 84
biomarcadors a la pràctica clínica diària. Tot i això, fins a la data, c ap dels biomarcadors
acceptats són 100% fiables, en tant que poden donar falsos positius (baixa especificitat) o
falsos negatius (baixa sensibilitat) (Issaq et al., 2011). En aquest sentit, l’ús combinat dels
biomarcadors amb altres mètodes (imatge, historial del pacient, etc.) ajuda a un millor
diagnòstic de la malaltia i una millor predicció de la resposta al tractament.
36
Introducció
Figura 12. Ús de múltiples e stratègies per a la identificació de biomarcadors
tumorals.
Imatge obtinguda de (Mabert et al., 2014).
Entre els biomarcadors proteics detectables a la sang es troben, per exemple, l’alfafetoproteïna o AFP (carcinoma hepatocel·lular) (Rich and Singal, 2014), l’antigen
carcinoembriogènic o CEA (càncer colorectal) (Balliet et al., 2011), l’antigen específic de
pròstata o PSA (càncer de pròstata) (Cuzick et al., 2014), el CA125 (càncer d’ovari) (Menon
et al., 2014), el CA19-9 (càncer de pàncrees) (Poruk et al., 2013), el CA27.29 i el CA15-3
(càncer de mama) (Duffy, 2006), etc. Tot ells són valorats a partir del sèrum o del plasma del
pacient mitjançant immunoassaigs i són útils per al diagnòstic de la malaltia, així com per a
la monitorització de la resposta al tractament (Mabert et al., 2014). A més, alguns d’aquests
marcadors, com el CEA, són utilitzats per a la detecció precoç de recidives un cop el tumor
primari ha estat eliminat i el pacient està aparentment curat (Duffy, 2001).
En
altres
casos,
s’utilitzen
les
biòpsies
del
tumor
per
analitzar,
per
immunohistoquímica (IHC), diferents biomarcadors que ajudaran a definir el tractament idoni
per al pacient (estratificació) (Roh, 2014). Per exemple, la presència del receptor d’estrògens
en el càncer de mama permet seleccionar el pacient per a un tractament endocrí (Ma et al.,
2009), mentre que la presència del receptor HER2 els selecciona per al tractament amb
l’anticòs monoclonal trastuzumab (Herceptin®) (Piccart, 2001) (Taula 2).
37
Taula 2. Selecció de biomarcadors proteics en ús a la pràctica clínica.
Tipus
Antígen
oncofetal
Biomarcador
Tipus de
tumor
Aplicació
Mostra
Mètode de
detecció
Alpha-feto proteina
(AFP )
Testicular
Hepatocel·lular
Avaluació del risc,
diagnòstic i monitorització
Sèrum
Immunoassaig
Antígen
carcinoembriogènic
(CEA)
Colorectal
Monitorització de la
resposta al tractament,
pronòstic i recurrència
Plasma
Immunoassaig
CA125
Ovari
Monitorització de la
resposta al tractament
Sèrum,
plasma
Immunoassaig
CA19-9
Pàncreas
Monitorització de la
resposta al tractament
Sèrum,
plasma
Immunoassaig
CA27.29
Mama
Monitorització de la
resposta al tractament
Serum,
plasma
Immunoassaig
CA15-3
Mama
Monitorització de la
resposta al tractament
Sèrum,
plasma
Immunoassaig
Ovari
Monitorització de la
resposta al tractament o
recurrencia
Sèrum
Immunoassaig
Ovari
Avaluació del risc i
diagnòstic
Sèrum
Immunoassaig
ROMA (CA125 i HE4)
Ovari
Avaluació del risc i
diagnòstic
Sèrum
Immunoassaig
Productes de la
degradació de Fibrina i
Fibronògen
Colorectal
Diagnòstic i monitorització
de la malaltia
Sèrum
Immunoassaig
Tiroglobulina
Tiroides
Monitorització de la
malaltia
Sèrum,
plasma
Immunoassaig
Antigen específic de
pròstata (PSA)
Pròstata
Diagnòstic i monitorització
de la malaltia
Sèrum
Immunoassaig
Receptor d’estrògens
(ER )
Mama
Pronòstic, predicció de
resposta, selecció per
teràpia hormonal
Teixit en
parafina
IHC
HER2
Mama
Pronòstic, selecció per
teràpia amb Trastuzmab
Teixit en
parafina
IHC
HE4 (Human epididymis
Antígens
tumorals
protein-4)
OVA1 (CA125,
prealbumina,
apolipoproteinaA-1, β2microglobulina i
transferrina)
Enzims
Receptors
L’anàlisi de les possibles mutacions presents en les cèl·lules tumorals també és de
gran importància per a l’estratificació dels pacients. Per exemple, les mutacions en el gen de
KRAS en el càncer colorectal fan que els tractaments amb cetuximab o panitumumab (antiEGFR) siguin inefectius (Adelstein et al., 2011). A la Taula 3 es mostren algunes de les
mutacions més ben caracteritzades en diferents tipus de càncer i el seu ús a la pràctica
clínica.
38
Introducció
Taula 3. Mutacions genètiques utilitzades com a biomarcadors en càncer.
Ús
Gen
Mutació
Càncer
Avaluació del
risc
BRCA1/2
Mutació, deleció
Mama i ovari
MLH1/MSH2
Mutació
Colorectal
Panell de DNA
(KRAS, APC i p53)
Mutació
Colorectal
HER2
Amplificació/sobreexpressió
Mama
MYC
Amplificació
Neuroblastoma
HER2
Amplificació/sobreexpressió
Mama
KRAS
Mutació
Colorectal
EGFR
Mutació
Pulmó (cèl·lula no petita)
BRAF
Mutació
Melanoma
EML4-ALK
Translocació
Pulmó (cèl·lula no petita)
BCR-ABL
Translocació
Leucèmia mieloide crònica
Cribratge
Pronòstic
Predicció del
tractament
Vigilància
Per tant, els biomarcadors tumorals són de gran importància no només per
diagnosticar la malaltia, sinó també per conèixer les característiques intrínseques del tumor
(companion diagnostic) i decidir la millor estratègia terapèutica per al pacient (teràpia
personalitzada). D'aquesta manera, s'optimitza l'ús dels fàrmacs, augmentant el seu èxit, i
reduint tant els efectes secundaris com els costos per al sistema sanitari.
1.6. Teràpia del càncer
Tot i els avenços en el coneixement de la malaltia, la mortalitat causa pel càncer tan
sols ha experimentat un descens del 5% en els darrers 50 anys. Els motius pels quals
aquesta malaltia és tan difícil de tractar i curar són diversos. D’una banda, a causa de la
inestabilitat genètica i la influència que tenen les cèl·lules malignes sobre el seu entorn, els
tumors són d’una gran heterogeneïtat, no només entre diferents pacients sinó també dins el
mateix teixit, de manera que el tractament no afecta per igual tota la massa tumoral (Cheng
and Chen, 2014). A més, s’han descrit mutacions en més de 400 gens que poden originar un
tumor, i, en molts d’aquests, es poden donar centenars o milers de mutacions diferents.
Gairebé tots els òrgans del cos humà poden ser afectats pel càncer, així com pràcticament
qualsevol tipus cel·lular. Per últim, un fet crucial per entendre la malaltia i la dificultat del seu
tractament és que els tumors no són estàtics, sinó que evolucionen i s’adapten a les
condicions del seu entorn, acumulant noves mutacions que fan variar les seves
característiques intrínseques (Duffy, 2013b). Davant d'aquesta gran complexitat, en molts
39
casos els tractaments són poc efectius, fent difícil la curació del pacient quan no hi ha hagut
una detecció precoç de la malaltia o no s'ha pogut intervenir quirúrgicament.
Més enllà de la cirurgia, que permet eliminar aquells tumors accessibles en estadis poc
avançats (sense metàstasi) i amb marges ben definits, la majoria d’estratègies terapèutiques
contra el càncer han estat dirigides a atacar diferents aspectes de la cèl·lula tumoral
directament, via la quimioteràpia o la radioteràpia i, més recentment, via l'ús de fàrmacs
(molècules químiques o anticossos monoclonals) dirigits (targeted therapies) basats en el
coneixement de les característiques intrínseques de la cèl·lula maligna que han donat origen
a la carcinogènesi (Sudhakar, 2009). Però s’ha de tenir en compte que les cèl·lules
estromals presents al microentorn tumoral són igualment fonamentals per a l’evolució de la
malaltia i la seva major estabilitat genètica fa que siguin menys susceptibles de
desenvolupar resistències (Quail and Joyce, 2013). Per això, a mesura que ha augmentat el
coneixement dels processos biològics subjacents, el tractament del càncer ha evolucionat
cap a una teràpia més dirigida a atacar el TME, no només eliminant-lo, sinó també
reeducant-lo perquè deixi de servir a la cèl·lula tumoral i la desprotegeixi davant de l’atac del
propi sistema immunitari o dels fàrmacs antitumorals (Hanahan, 2014). Segurament, la clau
de l'èxit en aquesta declarada "guerra contra càncer" es trobarà en combinar les estratègies
terapèutiques idònies basades en un coneixement profund de les característiques de la
cèl·lula tumoral i una disrupció de l'entorn que suporta el seu creixement.
Entre les teràpies centrades en les característiques pròpies de les cèl·lules tumorals,
s’han definit diferents estratègies per identificar possibles dianes contra les quals dirigir una
teràpia efectiva: 1) Una de les aproximacions és la comparació del patró d'expressió proteic
entre el teixit tumoral i el teixit sa per identificar proteïnes diferencials susceptibles de ser
bloquejades. Un exemple és la inhibició del receptor HER2 amb agents com el trastuzumab
(Herceptin®), el lapatinib o el pertuzumab (Browne et al., 2009). Aquest receptor es troba
sobreexpressat en alguns casos de càncer de mama (20% del total) i està implicat en el
creixement de la cèl·lula tumoral. 2) D'altra banda, s'han estudiat les mutacions gèniques
causants del creixement descontrolat com a possibles dianes. Per exemple, la proteïna
BRAF es troba mutada en el 50% de casos de melanoma, sent la mutació BRAF V600E la
més comú (Bello et al., 2013). El fàrmac vemurafenib (Zelboraf®) és un inhibidor de la funció
d'aquesta proteïna i va ser aprovat pel tractament de pacients amb melanoma inoperable o
metastàtic amb aquesta mutació (Sosman et al., 2012). 3) Per últim, una altra estratègia és
la cerca d'anormalitats cromosòmiques que poden donar lloc a proteïnes de fusió. Per
exemple, l’imatinib (Gleevec®) bloqueja la funció de BCR-ABL, una proteïna de fusió
causant de la leucèmia mieloide crònica (CML) (Sacha, 2014).
40
Introducció
A més, alguns tumors de pròstata i de mama mostren un creixement dependent
d’hormones (andrògens o estrògens i progesterona, respectivament). En aquests casos, la
teràpia hormonal, basada en una inhibició de l’origen de l'hormona o en un bloqueig de la
seva funció, ha tingut un efecte important sobre el creixement tumoral (Sudhakar, 2009). En
alguns casos, però, aquesta teràpia no és efectiva. Per exemple, un 20% dels càncers de
pròstata són resistents a la castració, per la qual cosa tenen un pitjor pronòstic (Bastos et al.,
2014). A més, entre un 10 i un 20% dels tumors de mama no tenen expressió dels receptors
hormonals ER o PgR, ni tampoc d’HER2, (triple negatius) (Boyle, 2012). La Taula 4 mostra
una selecció d’algunes de les teràpies dirigides centrades en característiques pròpies de la
cèl·lula tumoral.
Taula 4. Selecció de teràpies dirigides e specíficament contra la cèl·lula tumoral.
Marcador
Anomalia
Teràpia
Càncer
Receptor d’andrògens
Presència
Castració quirúrgica o
anàlegs de LHRH
Pròstata
Receptor d’estrogen o
progesterona
Presència
Tamoxifen o inhibidors
d’aromatasa
Mama
HER2
Amplificació/sobreexpressió
Trastuzumab, lapatinib,
pertuzumab
Mama i càncer
gàstric
EGFR + KRAS nativa
Amplificació/sobreexpressió
Cetuximab (ADCC),
panitumumab
Colorectal
EGFR
Activació independent del lligand
Gefitinib, erlotinib
NSCLC
BRAF
Hiperactivació (p.ex. Mutació
BRAF V600E)
Vemurafenib, dabrafenib
Melanoma
EML4-ALK
Translocació
Crizotinib
NSCLC
BCR-ABL
Translocació
Imatinib
CML
Aquest tipus de teràpia, però, té algunes limitacions ja que, sovint, la cèl·lula tumoral
troba mecanismes de resistència, ja sigui per una mutació en la diana que la insensibilitza al
tractament o bé per l’activació d’una via alternativa que li permeti deixar de dependre de la
diana bloquejada (Garraway and Janne, 2012). Per exemple, alguns pacients de CML
tractats amb imatinib desenvolupen resistència al tractament per l’aparició d’una mutació al
domini TKI de la proteïna de fusió BCR-ABL (Westin and Kurzrock, 2012). En aquests
casos, existeixen tractaments de segona generació que bloquegen la proteïna mutada, com
el dasatinib i el nilotinib. Un cas similar es dóna en el receptor EGFR, que pot adquirir la
mutació T790M que li confereix resistència al gefitinib o a l’erlotinib (Lovly et al., 2014). En
aquests casos, també s’han desenvolupat fàrmacs de segona generació com el neratinib,
l’afatinib o el dacomitinib per contrarestar la seva activitat.
41
D’altra banda, estan agafant cada cop més força l’ús d’agents dirigits a eliminar o
reeducar l’estroma tumoral per tal de desprotegir la cèl·lula maligna i afavorir l’eficàcia dels
tractaments esmentats. A la Figura 13 es mostra un resum de les aproximacions
terapèutiques més importants dirigides a reduir o eliminar diferents aspectes del microentorn
tumoral, entre les quals podem destacar, per exemple, les teràpies antiangiogèniques.
Figura 13. Estratègies terapèutiques dirigides contra l’estroma tumoral.
Figura obtinguda de (Joyce, 2005).
L’angiogènesi tumoral ha estat un dels processos que ha centrat l’interès de les
teràpies antitumorals durant les darreres dècades, culminant amb la introducció de diferents
fàrmacs antiangiogènics en la pràctica clínica (Limaverde-Sousa et al., 2014). Aquests
fàrmacs interfereixen en la senyalització del VEGF o d’altres factors de creixement sobre la
cèl·lula endotelial, ja sigui bloquejant el factor soluble (per exemple, el bevacizumab
(Avastin®) bloqueja el VEGF-A) o el receptor (via inhibidors de tirosina quinasa). En el cas
concret del bevacizumab, l’anticòs monoclonal reconeix de manera específica el VEGF,
bloquejant la seva unió al receptor (Ferrara et al., 2004). Aquest fàrmac ha estat aprovat pel
tractament de multitud de càncers (glioblastoma, càncer colorectal amb metàstasi, NSCLC i
càncer renal) en combinació amb altres fàrmacs (Miller et al., 2007; Sandler et al., 2006). La
Taula 5 mostra una selecció dels agents antiangiogènics aprovats fins a la data per al
tractament de diferents tipus de tumors.
42
Introducció
Taula 5. Selecció de fàrmacs antiangiogènics aprovats.
Agent
Tipus de inhibidor
Diana
Càncer
Bevacizumab (Avastin®)
Anticòs monoclonal
VEGF-A
CRC metastàtic
NSCLC
Glioblastoma
Carcinoma renal metastàtic
Aflibercept (Zaltrap®)
Receptor quimèric
soluble
VEGF-A, VEGF-B, PIGF
CRC metastàtic
Axitinib (Inlyta®)
Inhibidor tirosina
quinasa
VEGFR-1, -2 i -3,
PDGFR, KIT
Carcinoma renal avançat
Pazopanib (Votrient®)
Inhibidor tirosina
quinasa
VEGFR-1, -2 i -3,
PDGFR, KIT
Carcinoma renal avançat
Sarcoma avançat
Sorafenib (Nexavar®)
Inhibidor tirosina
quinasa
VEGFR-2 i -3, PDGFRs,
FGFRs Raf, KIT
Carcinoma hepatocel·lular
Carcinoma renal avançat
Sunitinib (Sutent®)
Inhibidor tirosina
quinasa
VEGFR-1, -2 i -3, KIT,
PDGFR, FLT3, CSF-1R,
RET
Vandetanib (Caprelsa®)
Inhibidor tirosina
quinasa
VEGFR-2, EGFR, KIT,
RET
Càncer medul·lar de
tiroides de fase tardana
Cabozantinib (Cometriq®)
Inhibidor tirosina
quinasa
VEGFR-2, RET, MET
Càncer medul·lar de
tiroides progressiu
Regorafenib (Stivarga®)
Inhibidor tirosina
quinasa
VEGFR, TIE-2, RET,
KIT, PDGFRs, FGFRs
CRC metastàtic
GIST
GIST
Carcinoma renal avançat
Tumor pancreàtic
metastàtic
Tot i la seva introducció en la pràctica clínica, cal destacar, que, com la majoria de les
teràpies sistèmiques, aquests fàrmacs no han produït una eficàcia perdurable ja sigui en
termes de reducció del tumor o latència (malaltia estable) o de supervivència a llarg termini.
Més aviat, el resultat comú és un retard en el temps de progressió després d'un període de
benefici clínic, suggerint l’aparició de mecanismes de resistència per part del tumor, lligats a
la supraregulació de vies proangiogèniques alternatives (Schweizer and Carducci, 2013).
D’altra banda, en els darrers anys han emergit les aproximacions terapèutiques que
modulen i reeduquen el sistema immunitari per potenciar la seva acció antitumoral
(immunoteràpies). Un exemple és l’ipilimumab (Yervoy®), un inhibidor del receptor CTLA-4
(de l’anglès Cytotoxic T Lymphocyte-associated Antigen 4) present als limfòcits T citotòxics i
que regula negativament la seva funció antitumoral (Sharma et al., 2011). Aquest anticòs
monoclonal va ser aprovat per al tractament del melanoma metastàtic avançat no operable i
s’està testant per al càncer de pròstata i de pulmó (Blank and Enk, 2014). A més, en
combinació amb l’ipilimumab, s’estan provant altres agents que potencien el seu efecte, com
el nivolumab, un anticòs contra el receptor PD1 (de l’anglès Programmed Death 1) (Page et
43
al., 2014). Aquest receptor es troba també als limfòcits T i la seva unió amb el lligand PD1L
(produït per les cèl·lules tumorals) limita la seva resposta citotòxica (Merelli et al., 2014).
Entre els fàrmacs utilitzats en la teràpia dirigida contra dianes específiques implicades
en el desenvolupament tumoral destaca l’ús dels anticossos monoclonals, que mostren una
major especificitat i menys efectes secundaris en comparació amb les molècules químiques
(Scott et al., 2012). Aquestes teràpies s’han establert durant els darrers 15 anys, basant-se
en un coneixement detallat dels mecanismes subjacents en la progressió tumoral i de la
funció dels factors solubles i els receptors susceptibles de ser bloquejats. Però els
anticossos monoclonals terapèutics no només funcionen com a antagonistes (per exemple,
el trastuzumab, el bevacizumab o l’ipilimumab) sinó que algunes aproximacions s’han
centrat a aprofitar les seves característiques pròpies per eliminar les cèl·lules tumorals
(Figura 14).
Figura 14. Mecanismes antitumoral s ba sats en l’ús d’anticossos monoclonal s.
a) Atac directe sobre la cèl·lula tumoral. b) Modulació i reeducació del sistema
immunitari. c) Reducció o eliminació del suport vascular i de l’estroma protumoral. Imatge
obtinguda de (Scott et al., 2012).
Per exemple, una utilitat terapèutica dels anticossos monoclonals és l’aprofitament de
la regió Fc per induir la mort de la cèl·lula tumoral via l’activació de la resposta ADCC
44
Introducció
(Winiarska et al., 2011). Alguns anticossos amb aquesta capacitat són el trastuzumab o el
cetuximab (Collins et al., 2012; Kimura et al., 2007).
A més, noves tendències terapèutiques s’han focalitzat en la utilització dels anticossos
monoclonals per dirigir agents citotòxics específicament al tumor, reduint la seva toxicitat
sistèmica (els anomenats ADC, de l’anglès Antibody-Drug Conjugate). Un exemple és el TDM1 (trastuzumab conjugat a l’agent citotòxic emtansine), que ha estat aprovat per al
tractament del càncer de mama, amb esperançadors resultats en comparació amb les
teràpies estàndard (Bender et al., 2014; Bighin et al., 2013).
En aquest punt, és important esmentar que els anticossos monoclonals que s’utilitzen
en la pràctica clínica necessiten ser adaptats per tal d’evitar la reacció immunogènica del
pacient. A l’apartat 1.6.1. s’explica amb més detall l’obtenció preclínica de les formes
quimèriques i humanitzades dels anticossos terapèutics.
Com s’ha esmentat anteriorment, tot i els avenços duts a terme en el
desenvolupament de noves estratègies terapèutiques, continuen existint algunes limitacions
que poden reduir l’efectivitat tant dels anticossos monoclonals com de les molècules
químiques (Scott et al., 2012), ja sigui per l’aparició de resistències o per les pròpies
característiques del tumor i de l’agent terapèutic en concret (Taula 6). En aquest sentit, la
combinació de diferents fàrmacs contra la mateixa via o de les teràpies dirigides amb els
quimioterapèutics ha demostrat ser una bona alternativa per evitar l’aparició de resistències
(Baxevanis et al., 2009).
A més, està descrit que, en les vies d’escapament al fàrmac, hi juga un paper
determinant la comunicació entre els diferents tipus cel·lulars dins el tumor. Per tant, l’atac
simultani dels diferents compartiments dificultarà en gran mesura l’aparició d’aquests
mecanismes, augmentant l’efectivitat dels fàrmacs (Quail and Joyce, 2013).
Actualment, s’estan utilitzant nombroses combinacions com a teràpia estàndard en
diferents tipus de càncer. Per exemple, la combinació trastuzumab + lapatinib per al
tractament de càncer de mama (de Azambuja et al., 2014) o la gemcitabina + erlotinib per al
tractament del càncer de pàncrees (Van Cutsem et al., 2014). A més, s’estan duent a terme
nombrosos estudis clínics per definir noves combinacions efectives, com per exemple la
combinació ipilimumab + darcarbazina (Sherrill et al., 2013) en el tractament de melanoma o
la de bevacizumab + mFOLFOX6 (una combinació dels quimioterapèutics: àcid folinic, 5fluoracil i oxaliplatí) per al tractament del càncer colorectal metastàtic (O'Neil et al., 2014).
Cal tenir en compte, però, que el tractament dels pacients amb una combinació de fàrmacs,
45
pot provocar un augment dels efectes secundaris, per la qual cosa s’ha de valorar amb
deteniment la relació entre els riscos i els beneficis de cada estratègia.
Taula 6. Possible s mecanismes per una reducció en la resposta al tractament.
Propietat de l’agent terapèutic
Motius per una resposta reduïda
Unió a antigen o receptor
Heterogeneïtat de l’antigen o del receptor (inicial o adquirida)
Infraregulació de l’expressió de l’antigen o el receptor
Farmacocinètica
Estabilitat de l’agent
Immunogenicitat
Vida mitjana
Penetrància i concentració intratumoral
Permeabilitat vascular
Pressió intersticial
Mida de l’agent i afinitat
Bloqueig de receptors
Baixa concentració agent/receptor
Saturació del receptor amb un bloqueig inefectiu de la seva
dimerització i senyalització
Bloqueig de vies de senyalització
Via no rellevant per a la progressió tumoral
Presència inicial o adquirida de vies de senyalització
compensatòries
Promiscuïtat de les vies de senyalització
Funció immune efectora
Isotip de l’anticòs terapèutic
Polimorfisme del FcγR
Evasió immune
Inhibició del sistema del complement
Inducció de la resposta de les cèl·lules T
Supressió immune
Alliberament de toxines
Concentració inadequada a nivell tumoral
Resistència a la toxina (inicial o adquirida)
Amb tot, el coneixement cada dia més ampli dels mecanismes que donen suport a la
progressió tumoral està obrint noves oportunitats terapèutiques que, en combinació amb les
ja existents, poden suposar un gran avenç en la cura d’una malaltia tan complexa com el
càncer.
1.6.1. Desenvolupament d’anticossos monoclonals terapèutics
Des que, l’any 1975, els guanyadors del premi Nobel, Georges Köhler i Cesar Milstein
van aconseguir obtenir hibridomes a partir de la fusió de cèl·lules B productores d’anticòs
amb cèl·lules de mieloma immortalitzades (Kohler and Milstein, 1975), els anticossos
monoclonals (en la seva majoria immunoglobulines G) han esdevingut unes eines
extremadament versàtils en la medicina i la recerca biològica.
Les immunoglobulines G (IgGs) són un complex de proteïnes compost per quatre
cadenes peptídiques unides per ponts disulfur: dues cadenes pesades idèntiques entre si
46
Introducció
(de 50 kDa) i dues cadenes lleugeres també idèntiques (de 25 kDa) (Figura 15). Les
cadenes pesades contenen 3 regions constants (C H 1, CH 2 i CH 3) i una regió variable (VH ), i
les cadenes lleugeres tan sols contenen una regió constant (C L) i una regió variable (VL).
Mentre que les regions constants són altament conservades dins una espècie, les regions
variables contenen les majors diferències. És en aquesta zona on es troben les regions
determinants de la complementarietat o CDRs (3 en cada cadena), per on es dóna el
reconeixement específic de l’antigen, flaquejades per 4 frameworks (FR) (Georgiou et al.,
2014).
Figura 15. Estructura quaternària i regions d’una immunoglobulina G.
Imatge obtinguda de (Georgiou et al., 2014)
L’ús dels anticossos monoclonals per a aplicacions terapèutiques ha evolucionat
considerablement en les darreres dècades. L’obtenció d’hibridomes a partir de la
immunització de ratolins dóna lloc a anticossos monoclonals murins, que, inicialment es van
utilitzar sense modificacions per al tractament de malalties en humans (Scott et al., 2012).
Aquesta pràctica, però, va donar lloc a l’observació d’una reacció immunogènica en els
pacients, mitjançant la producció dels anomenats HAMA (de l’anglès Human Anti-Mouse
Antibody), que limitava l’efectivitat del tractament (Khazaeli et al., 1994). Per evitar aquesta
problemàtica, es van desenvolupar diferents estratègies basades en l’enginyeria
d’anticossos per incorporar regions humanes en substitució de les regions murines de
l’anticòs (Figura 16). D’aquesta manera, a més de reduir la immunogenicitat, els anticossos
modificats tenen una millor farmacocinètica i una millor funció efectora, a causa de l’afinitat
dels receptors Fc de les cèl·lules humanes (Glassman and Balthasar, 2014).
47
In vitro antibody libraries
Transgenic mouse
Human Hybridomas
Mouse hybridoma
Mouse
Chimeric
Humanized
Human
Genetic engineering
V gene cloning
CDR grafting
Eukaryotic expression
Figura 16. Estratègies per a l’obtenció d’anticossos modificats.
Imatge obtinguda de (Brekke and Sandlie, 2003)
La generació d’anticossos quimèrics (amb les regions constants humanes i les regions
variables murines) va suposar un important pas endavant en la reducció de la
immunogenicitat (Boulianne et al., 1984). Tot i això, s’ha observat l’aparició d’anticossos
contra aquestes formes quimèriques (els anomenats HACA, de l’anglès Human AntiChimeric Antibody) en diferents estudis (Miele et al., 2004; Saito et al., 2005). Amb l’objectiu
de reduir encara més la reacció immunològica del pacient, Greg Winter i altres van descriure
una metodologia anomenada CDR-grafting basada en la incorporació dels CDR murins en
un esquelet completament humà (Jones et al., 1986), donant lloc als anticossos
humanitzats. Aquesta pràctica, però, produïa una pèrdua significativa de l’afinitat per
l’antigen. Més tard, Foote i Winter van identificar una sèrie de residus presents als
frameworks, que interaccionen amb els CDR i que eren importants per a l’estructura
tridimensional de l’anticòs i pel reconeixement de l’antigen (Foote and Winter, 1992). La
preservació d’aquests aminoàcids (també anomenats residus de la zona de Vernier) en la
forma humanitzada de l’anticòs permet conservar la seva afinitat.
Darrerament, a més, s’han desenvolupat diferents tecnologies (llibreries genètiques,
ratolins
transgènics
i hibridomes
humans)
que permeten l’obtenció d’anticossos
completament humans, evitant així els possibles problemes derivats de la modificació de la
seqüència murina (Lonberg, 2008).
48
Introducció
Tot i aquestes consideracions genèriques, és possible que en alguns casos particulars,
determinats anticossos humanitzats o fins i tot quimèrics siguin menys immunogènics que
alguns anticossos completament humans (Harding et al., 2010).
Des de 1997, catorze anticossos monoclonals han estat aprovats per la FDA per al
tractament de diversos tipus de tumors sòlids i càncers hematològics (Taula 7), mentre que
10 més estan sent testats actualment en fases clíniques (Glassman and Balthasar, 2014).
Taula 7. Anticossos monoclonals aprovats per la FDA en teràpia oncològica.
Anticòs
Tipus
Diana
Indicacions
Mecanisme d’acció
Rituximab
(Rituxan®)
Quimèric
IgG1
CD20
Limfoma no Hodgkin
ADCC, CDC, Inducció
d’apoptosi
Trastuzumab
(Herceptin®)
Humanitzat
IgG1
HER2
Càncer de mama (HER2+)
Càncer gàstric (HER2+)
Inhibició de la senyalització i
ADCC
Alemtuzumab
(Campath®)
Humanitzat
IgG1
CD52
Leucèmia limfocítica crònica
de cèl·lula B
CDC, inducció d’apoptosi
Ibritumomab tiuxetan
(Zevalin®)
Murí
IgG1
CD20
Limfoma no Hodgkin
Alliberament de radioisòtop
(90Y)
Tositumomab
(Bexxar®)
Murí
IgG2a
CD20
Limfoma no Hodgkin
Alliberament de radioisòtop
(131I), ADCC, CDC, inducció
d’apoptosi
Cetuximab
(Erbitux®)
Quimèric
IgG1
EGFR
Carcinoma de cèl·lula
escamosa de cap i coll
Carcinoma colorectal
Inhibició de la senyalització,
ADCC, CDC
Inhibició de la senyalització
de VEGF
Bevacizumab
(Avastin®)
Humanitzat
IgG1
VEGF
Carcinoma colorectal
metastàtic
NSCLC
Glioblastoma
Càncer renal metastàtic
Panitumumab
(Vectibix®)
Humà
IgG2
EGFR
Carcinoma colorectal
metastàtic
Inhibició de la senyalització,
ADCC
Ofatumumab
(Arzerra®)
Humà
IgG1
CD20
Leucèmia limfocítica crònica
ADCC, CDC
Denusumab
(Xgeva®)
Humà
IgG2
RANKL
Metàstasi òssia
Inhibició de la senyalització
Ipilimumab
(Yervoy®)
Humà
IgG1
CTLA4
Melanoma metastàtic
Inhibició de la senyalització
Brentuximab vedotin
(Adcetris®)
Quimèric
IgG1
CD30
Limfoma Hodgkin
Alliberament de la toxina
auristatina (ADC)
Pertuzumab
(Perjeta®)
Humanitzat
IgG1
HER2
Càncer de mama
Inhibició de la senyalització,
ADCC
Trastuzumab emtansina
(Kadcyla®)
Humanitzat
IgG1
HER2
Càncer de mama
ADC. Inhibició de la
senyalització, ADCC
Per tant, l’ús d’anticossos monoclonals per a teràpia en oncologia ha estat una
tendència a l’alça en els darrers anys, a causa de la seva versatilitat pel que fa a
mecanismes d’acció i als avantatges que ofereixen en comparació amb les molècules
químiques, com són: una menor eliminació (permetent espaiar les dosis), una elevada
afinitat i una menor toxicitat per unions inespecífiques (Glassman and Balthasar, 2014).
49
Introducció
51
Ob jectius
2. OBJECTIUS
El coneixement cada dia més profund dels processos que regulen la progressió
tumoral, des de la transformació de la cèl·lula maligna fins a la colonització metastàtica, ha
revelat l’existència de noves oportunitats terapèutiques. En aquest sentit, les estratègies
utilitzades en el tractament del càncer han evolucionat amb l’objectiu d’actuar, no només
sobre les cèl·lules tumorals, sinó també sobre la resta de components de l’estroma (cèl·lules
endotelials, fibroblasts i cèl·lules immunes). Aquests components del microentorn donen
suport al creixement de la cèl·lula maligna mitjançant una comunicació paracrina en què
intervenen multitud de factors. La identificació i la regulació d’aquells factors clau en aquest
diàleg donarà lloc a teràpies més efectives que, junt amb les utilitzades actualment,
contribuiran a la desestabilització del microentorn tumoral i, en darrer terme, a una millora en
el tractament de la malaltia.
Entre aquests factors, ha cobrat protagonisme la família de proteïnes d’unió a calci
S100, i, en concret, la proteïna S100A7. Tot i que existeixen poques dades experimentals
sobre la seva activitat, està descrit que aquesta proteïna té funcions relacionades amb la
mobilitat tant de la cèl·lula tumoral, com de la cèl·lula endotelial i la immune, correlacionant
la seva expressió amb un major creixement tumoral i una major capacitat metastàtica. A
més, algunes dades clíniques han mostrat una relació directa entre la seva presència i un
pitjor pronòstic per als pacients amb càncer de mama o amb càncer de cap i coll. Per últim,
la S100A7 s’ha trobat en biofluids com la sang i l’orina de pacients amb càncer de pulmó,
bufeta i melanoma, de manera que s’ha proposat com un possible biomarcador tumoral.
Aquest conjunt de dades donen una idea de la importància de la proteïna en el
desenvolupament tumoral, però existeix la necessitat d’aprofundir en el seu mecanisme
d’acció per tenir una visió integradora de la seva funció en els diferents compartiments
cel·lulars. A més, l’absència d’inhibidors específics contra la S100A7 obre l’oportunitat de
desenvolupar anticossos monoclonals dirigits a bloquejar la seva funció extracel·lular com
una nova estratègia per al tractament del càncer, i poder demostrar així el seu valor
terapèutic.
Per tant, els objectius principals i específics d’aquest treball són:
x
Estudiar el mecanisme d’acció de la proteïna S100A7 sobre els diferents
compartiments cel·lulars dins del tumor (cèl·lula endotelial, cèl·lula immune,
fibroblast i cèl·lula tumoral).
53
-
Estudiar l’efecte induït per la proteïna sobre processos cel·lulars com la
proliferació, la migració i l’adhesió.
-
Determinar els factors de creix ement i citoquines secretades en res posta a la
S100A7 i aprofundir en les vies de senyalització activades en presència de la
proteïna.
-
A valuar la funció de la S100A7 sobre l’establiment del nínxol premetastàtic en un
model in vivo de metàstasi experimental.
x
Demostrar la prova de principi de la teràpia antitumoral amb anticossos
monoclonals específics contra la proteïna S100A7 en un model animal.
-
Obtenir anticossos monoclonals específics contra la prote ïna S100A 7.
-
Desenvolupar un mètode de cribratge molecular basat en la interacció S 100A 7RAGE per a la selecció d’anticossos funcionals.
-
Seleccionar els anticossos monoclonals en bas e a la seva capacitat bloquejant de
l’efecte de la proteïna en assaigs in vitro.
-
Caracteritzar el creixement tumoral subcutani i l’expressió de S100A7 de la línia de
carcinoma epidermoide A431 i estudiar l’eficàcia dels anticossos monoclonals a
nivell de creixement i d’angiogènesi.
-
Dissenyar formes humanitzades de l’anticòs candi dat mitjançant la tècnica del
CDR-grafting.
x
Estudiar el valor diagnòstic de la proteïna S100A7 en biofluids derivats de models
animals.
-
Obtenir un k it basat en la tècnica del sandwic h ELISA per quantificar la prot eïna
S100A7 en diferents biofluids, com la sang.
-
Quantificar els nivells de la proteïna al plasma d’ animals amb i sense tumor.
54
Materials i Mètodes
55
Materials i Mètodes
3. MATERIALS I MÈTODES
3.1. Clonatge, producció i purificació de la proteïna recombinant
S100A7
El fragment codificant per la seqüència de la proteïna S100A7 humana es va obtenir
per reacció en cadena de la polimerasa (PCR) a partir de DNA complementari (cDNA) de la
línia cel·lular humana de càncer de mama MDA-MB-468. Els encebadors utilitzats per a la
seva amplificació van ser 5’-ac tca cat atg agc aac act caa gct gag agg tcc ata ata g-3’ i 5’-a
ctc atg agc tca tca ctg gct gcc ccc gga aca ggg cgc tgc-3’. El producte directe de PCR es va
lligar dins el vector pGEMT-Easy (Promega) i es van transformar cèl·lules competents de la
soca E. coli JM109. Cinc clons positius es van seleccionar i comprovar per seqüenciació de
DNA. A continuació, del clon escollit, es va alliberar la banda digerint amb l’enzim de
restricció NdeI i es va clonar dins el vector d’expressió per a procariotes pET28a(+)
(Novagen), al mateix lloc de restricció. Amb aquesta nova construcció es van transformar
cèl·lules competents de la soca E. coli TunerTM (DE3) (Novagen) per produir la proteïna.
Després de provar diferents temps d’inducció i concentracions d’imidazol, el protocol
optimitzat per a la producció i purificació de la proteïna S100A7 amb el clon seleccionat
(amb direccionalitat i pauta de lectura correctes) va ser el següent: l’expressió es va induir
amb 1 mM de isopropyl-D-thiogalacto-pyranoside (IPTG; Sigma). A les 6 hores, el cultiu
bacterià es va recollir, es va centrifugar a 4.000 rpm i el pellet resultant es va congelar fins al
seu ús.
Un cop comprovat per SDS-PAGE (de l’anglès sodium dodecyl sulfate polyacrylamide
gel electrophoresis) al 15% d’acrilamida que la producció havia estat correcta, el pellet es va
resuspendre en tampó de lisi (lisozima (Sigma) 100 μg/ml, NaCl 0.5 M, Na2 HPO4·2 H2O 10
mM, NaH2PO4·2 H2O 10 mM i imidazol (Sigma) 20 mM, pH 7.5.), i es va deixar al bany a
30ºC durant 15 minuts. A continuació, es va sotmetre el lisat a sonicació a 4ºC (polsos
ON/OFF de 0.5”/1” al 30% d’intensitat, durant 1 minut). Després de centrifugar a 12.000 rpm
durant 20 minuts a 4ºC, el producte es va purificar utilitzant una columna d’afinitat HisTrapTM
Chelating affinity column (Amersham) i el sistema ÄKTATM Purifier 100 (GE Healthcare).
Després de passar la mostra per la columna, la proteïna retinguda es va rentar passant
tampó de purificació (NaCl 0.5 M, Na2 HPO4·2 H2O 10 m M, NaH2PO4·2 H2O 10 m M i imidazol
(Sigma) 20-500 mM, pH 7.5.) amb concentracions creixents d’imidazol. La proteïna S100A7
va eluir a 300 mM d’imidazol. L’eficiència del procés i la puresa de la proteïna es van
analitzar per SDS-PAGE al 15% d’acrilamida.
57
Les fraccions d’elució on es trobava la proteïna recombinant es van concentrar i
tamponar amb PBS (NaCl 137 mM, KCl 2.7 mM, Na 2HPO4 10 mM i KH2PO4 2 mM, pH 7.4)
utilitzant el sistema Amicon Ultra-15 centrifugal filter Units, 10.000 MWco, (Millipore).
Després d’esterilitzar-la amb filtres de 0.22 μm, la proteïna es va quantificar utilitzant un
NanoDrop® 2000c (Thermo), d’acord amb l’expressió:
Concentració de proteïna (mg/ml) =
Absorbància a 280 nm
ª coeficient d'extinció molar º
«
»
pes molecular
¬
¼
El coeficient d’extinció molar per a la proteïna S100A7 humana amb cua d’histidines a
280 nm és de 4470 M-1 cm -1 i el seu pes molecular és 13.634,3 Daltons (Da).
En el cas de la S100A7 murina, la proteïna recombinant es va obtenir mitjançant el
mateix sistema que per a la S100A7 humana. Es va amplificar a partir de cDNA de la línia
cel·lular de fibroblast murí NIH3T3 amb els encebadors 5’-ac tca cat atg cca gac aca acc agt
gga gga ctc cct ctt c-3’ i 5’-a ctc atg agc tca cta gta gag gct gtg ctc agt aca gta gtg-3’.
Per a alguns experiments, va ser necessari treure la cua d’histidines de la proteïna
recombinant. Amb aquest propòsit, es va utilitzar la proteasa trombina (Novagen) que
reconeix la seqüència Leu-Val-Pro-Arg-Gly-Ser, tallant per Arg-Gly. Com a resultat, la
proteïna S100A7 digerida té tres aminoàcids addicionals a l’extrem N-terminal (Gly-Ser-His)
(vegeu Figura 1 de Resultats). Després de la digestió, la cua d’histidines es va eliminar per
cromatografia d’afinitat amb columna HisTrapTM Chelating affinity column.
D’altra banda, el nivell d’endotoxines present en la proteïna recombinant es va
quantificar utilitzant el kit QCL-1000 Chromogenic LAL (Lonza), seguint les instruccions del
fabricant.
3.2. Generació i caracterització d’anticossos monoclonals específics per a la proteïna S100A7
3.2.1. Obtenció de les línies d’hibridoma productores d’anticòs
Les línies d’hibridoma productores d’anticòs es van obtenir seguint el protocol descrit
prèviament (Kohler and Milstein, 1975), amb modificacions. En concret5, ratolins de la soca
BALB/cAnNHsd (Harlan) es van immunitzar amb 50 μg de proteïna S100A7 humana sense
cua d’histidines per via subcutània per un total de tres dosis espaiades cada tres setmanes.
58
Materials i Mètodes
La primera inoculació es va fer junt amb adjuvant complet de Freund (CFA) (Sigma), mentre
que les dues darreres es van fer junt amb adjuvant incomplet de Freund (IFA) (Sigma).
Passat aquest temps, la titulació d’anticossos es va valorar per ELISA (de l’anglès EnzymeLinked Immunosorbent Assay) de la següent manera: es va fer un recobriment de la placa
d’ELISA (Nunc TM MaxiSorp TM) amb 50 μl/pou de S100A7 humana recombinant a 3 μg/ml en
PBS. Després de tota la nit a 4ºC, es van fer 2 rentats amb tampó PBS-HT (NaCl 280 mM,
KCl 2.7 mM, Na 2HPO4 10 mM, KH2PO4 2 m M i 0.1% Tween-20, pH 7.4.) i els sèrums dels
animals es van incubar a diferents dilucions (entre 2.000 i 256.000 vegades) en medi de
cultiu DMEM (Sigma) al 10% de FCS (de l’anglès Fetal Cow Serum) (PAA), a partir d’ara
medi complet. Després de 2 hores a 37ºC, la placa es va rentar 5 cops amb PBS-HT i es va
incubar l’anticòs de cabra anti-IgG/IgM murina conjugat a peroxidasa (Jackson) diluït a
1/12.500 en medi complet durant 30 minuts a 37ºC. Per últim, la placa es va rentar i es van
afegir 50 μl/pou de substrat TMB (de l’anglès Tetramethylbenzidine) (Sigma). Als 5 minuts, la
reacció colorimètrica es va aturar amb 50 μl/pou de HCl 1 M i la lectura a 450 nm es va
realitzar amb el lector de plaques Multiskan Ascent (Thermo). El ratolí amb el major nivell
d’immunització es va seleccionar per a l’obtenció dels hibridomes.
La melsa del ratolí es va extreure i es va disgregar mecànicament per tal d’obtenir els
limfòcits B. Aquestes cèl·lules es van fusionar amb cèl·lules de Friendly Myeloma (vegeu
apartat 3.4) en una proporció 1/10, seguint el següent protocol: a la barreja de cèl·lules es va
afegir fins a 1 ml de polietilenglicol (PEG) (Merck) temperat a 37ºC, durant 1 minut (50 μl
cada 3 segons), en constant agitació. A continuació, es van afegir fins a 24 ml de medi de
cultiu RPMI 1640 (Sigma) a 37ºC, durant 4 minuts. Després de centrifugar les cèl·lules, es
van comptar i es van plaquejar en plaques de cultiu de 96 pous (Nunc) a raó de 100.000
cèl·lules/pou (cp) en 100 μl de medi d’hibridoma (40% CD-Hybridoma (Sigma), 20% DMEM
(Sigma), 20% F12 (Sigma), 20% sèrum fetal boví (FCS) i suplementat amb 1% HAT
(hipoxantina, aminopterina, timidina) (GibcoBRL)). Als 7 dies de sembrar les plaques, es van
afegir 100 μl/pou de medi mixt (40% CD-Hybridoma (Sigma), 20% DMEM (Sigma), 20% F12
(Sigma), 20% FCS i suplementat amb 1% HT (Hipoxantina, Timidina) (GibcoBRL)). Passats
10 dies, el sobrenedant de cada pou es va analitzar per ELISA mitjançant el protocol descrit
anteriorment. Es van seleccionar els clons productors d’anticòs anti-S100A7 i es van
expandir i congelar en medi de congelació (FCS al 10% de DMSO) per fer els clonatges
posteriors.
Cada hibridoma inicial es va clonar dos cops, seleccionant en cada ronda el clon més
secretor. Els dos clonatges consecutius es van fer per dilució límit en medi mixt,
seleccionant, primer, els clons productors obtinguts en 0.1 cèl·lula/pou i, segon, els clons
obtinguts en 0.01 cèl·lula/pou, per tal de garantir l’origen clonal del cultiu. De cada hibridoma
59
es va seleccionar un clon final de 0.01 cèl·lula/pou, que es va expandir i adaptar a medi
DMEM/F12 (40% DMEM (Sigma), 40% F12 (Sigma) i 10% FCS).
3.2.2. Producció i purificació dels anticossos anti-S100A7
Cada hibridoma es va sembrar en flascons Cell Culture Treated TripleFlasks™ (Nunc),
en 100 ml de medi DMEM/F12. Quan la confluència va arribar al 80%, es van fer dos rentats
de 10 minuts amb 100 ml de PBS-Ca2+/Mg2+ (PBS amb 1 mM de CaCl2 i 0.5 m M de MgCl2) i
es van afegir 200 ml de medi de producció (50% medi DMEM, 50% medi F12, glutamina 8
mM, piruvat sòdic 2 mM, 0.5% peptona i 0.0125% citrat fèrric). Als 8 dies, es van recollir els
200 ml de medi de producció, es van centrifugar i es van congelar per a la seva purificació.
El procés es va repetir fins a tenir el volum de sobrenedant necessari per obtenir 10 mg (per
a l’anàlisi in vitro) o 100 mg (per a l’estudi in vivo) d’anticòs.
La purificació dels anticossos a partir del sobrenedant de cada hibridoma es va fer
utilitzant el sistema ÄKTATM Purifier 100 (GE Healthcare) i una columna HiScale 16/40 (GE
Healthcare) amb resina de proteïna A, amb elevada capacitat de retenció, MabSelect
SuReTM LX (GE Healthcare). El sobrenedant es va tamponar amb un 10% de tampó d’unió
10X (Na3PO4 500 mM) i un 5% de sal 20X (NaCl 3 M), es va ajustar el pH a 7.2 i es va filtrar
per 0.22 μm. Després d’equilibrar la columna amb tampó d’unió (Na3PO4 50 mM i NaCl 150
mM, pH 7.2), es va passar el sobrenedant. A continuació, es va rentar amb tampó d’unió i es
va aplicar el tampó d’elució (Citrat sòdic 0.1 M, pH 3), recol·lectant l’eluït en fraccions de 10
ml. Als tubs recol·lectors es van posar 5 ml de tampó d’equilibrat (Tris-HCl 1 M, pH 8), per tal
que el pH final de les fraccions recol·lectades quedés pròxim a 7.5. Per últim, la resina de la
columna es va netejar amb tampó de regeneració (NaOH 0.1 M). L’eficiència del procés i la
puresa de l’anticòs es va analitzar per SDS-PAGE al 12% d’acrilamida.
Les fraccions d’elució on es trobava l’anticòs es van concentrar i tamponar amb PBS
utilitzant el sistema Amicon Ultra-15 centrifugal filter Units, 30.000 MWco, (Millipore).
Després de filtrar en condicions estèrils per 0.22 μm, l’anticòs es va quantificar utilitzant un
NanoDrop® 2000c (Thermo), d’acord amb l’expressió utilitzada en l’apartat 3.1. El coeficient
d’extinció molar per a la IgG murina a 280 nm és de 210.000 M-1 cm -1 i el seu pes molecular
és 150.000 Daltons (Da).
60
Materials i Mètodes
3.2.3. Caracterització dels anticossos
3.2.3.1.
Determinació de l’isotip
L’isotip dels anticossos purificats es va determinar utilitzant el kit SBA Clonotyping
System-HRP (SouthernBiotech), seguint les instruccions del fabricant.
3.2.3.2.
Especificitat
La determinació de l’especificitat dels anticossos obtinguts contra la proteïna S100A7
es va fer per ELISA. Les proteïnes recombinants S100A2 (Abnova), S100A4 (LEITAT),
S100A6 (Abnova), S100A7 (LEITAT), S100A14 (LEITAT), S100B (Sigma) i S100P (LEITAT),
es van utilitzar com a recobriment de la placa d’ELISA (Nunc TM MaxiSorp TM) a 0.5 μg/ml en
PBS. Després de tota la nit a 4ºC, es va rentar 2 cops amb PBS-HT i es va bloquejar amb
PBS al 1% de llet desnatada en pols durant 1 h a 37ºC. La incubació dels anticossos es va
fer durant 2 hores a 37ºC a una concentració de 5 μg/ml en tampó de bloqueig. Després de
rentar 5 cops amb PBS-HT, es va incubar l’anticòs secundari de cabra anti-IgG/IgM murina
conjugat a peroxidasa (Jackson) diluït a 1/12.500 en tampó de bloqueig durant 1 hora a
37ºC. Per últim, es va rentar i es va revelar amb el substrat TMB. La lectura de la placa es
va fer a 450 nm amb l’espectrofotòmetre Multiskan Ascent (Thermo), després d’aturar la
reacció amb HCl 1 M.
Per determinar si els anticossos obtinguts reconeixien les formes humana i murina de
la proteïna S100A7, es va realitzar una electroforesis SDS-PAGE al 15% d’acrilamida i un
western blot (tal com s’explica a l’apartat 3.4.3), amb 5 ng de la proteïna recombinant
humana i 5 μg de la proteïna recombinant murina.
3.2.3.3.
Sensibilitat
Per valorar la sensibilitat dels anticossos anti-S100A7, es va recobrir una placa
d’ELISA (Nunc TM MaxiSorpTM) amb la proteïna recombinant humana a concentracions des
de 500 ng/ml fins a 0.131 ng/ml (dilucions 1:2,5). Després de rentar 2 cops amb PBS-HT, es
van incubar els anticossos a una concentració fixa de 1 μg/ml en PBS al 10% de FCS durant
2 h a 37ºC. Els pous es van rentar 5 cops amb PBS-HT i es va afegir l’anticòs secundari de
cabra anti-IgG/IgM murina conjugat a peroxidasa (Jackson) diluït a 1/12.500 en PBS al 10%
FCS durant 1 hora a 37ºC. Per últim, es va rentar i el senyal es va revelar amb substrat
TMB. Després d’aturar la reacció amb HCl 1M, es va llegir l’absorbància a 450 nm amb
l’espectrofotòmetre Multiskan Ascent (Thermo). Com a blanc (soroll de fons) es va fer servir
el senyal obtingut als pous amb 500 ng/ml de S100A7 on no es va incubar anticòs primari.
61
El límit de detecció dels anticossos en les condicions indicades va ser donat per la
concentració de S100A7, en què l’absorbància va ser superior a la mitjana de l’absorbància
del blanc + 3 cops la seva desviació estàndard (SD).
3.3. Línies cel·lulars i condicions de cultiu
La línia cel·lular humana d’adenocarcinoma de mama triple negatiu MDA-MB-231
(HTB-26TM; ATCC®), la línia cel·lular humana de carcinoma epidermoide A431 (CRL-1555TM;
ATCC®), la línia cel·lular murina d’adenocarcinoma de còlon CT26 (CRL-2638TM; ATCC®) i
la línia cel·lular murina de fibroblast embrionari NIH3T3 (CRL-1658™; ATCC®) es van
cultivar en medi DMEM high glucose 4500 mg/L (Sigma) suplementat amb un 10% de FCS
(PAA). La línia cel·lular humana d’adenocarcinoma de mama triple negatiu MDA-MB-468
(HTB-132TM; ATCC®) i la línia cel·lular de monòcit humà THP1 (TIB-202 TM; ATCC®) es van
cultivar en medi RPMI 1640 (Sigma) suplementat amb un 10% de FCS. La línia cel·lular de
fibroblast humà BJ (CRL-2522TM ; ATCC®) es va cultivar en medi MEM (Sigma) suplementat
amb un 10% de FCS. La línia cel·lular endotelial humana de vena umbilical HUVEC (Lonza)
es va cultivar sobre un recobriment de gelatina al 1% (Merck Millipore) en medi EBM (Lonza)
suplementat amb rhEGF, hidrocortisona, àcid ascòrbic, extracte de cervell boví i gentamicina
(EGM BulletKit, Lonza) i amb un 10% de FCS.
Per a l’obtenció d’anticossos, es va cultivar la línia murina de mieloma, derivada de p3X63-Ag8.653 (CRL-1580TM; ATCC®) i anomenada Friendly Myeloma, en medi DMEM/F12
(40% DMEM (Sigma), 40% F12 (Sigma) i 10% FCS). Els hibridomes productors d’anticòs es
van cultivar en medi mixt (40% CD-Hybridoma (Sigma), 20% DMEM (Sigma), 20% F12
(Sigma), 20% FCS i suplementat amb 1% HT (Hipoxantina, Timidina) (GibcoBRL)) durant els
clonatges i posteriorment es van adaptar a medi DMEM/F12 al 10% de FCS per a la seva
expansió i producció a petita i mitjana escala (com s’ha detallat a l’apartat 3.2.2.).
Totes les línies es van mantenir a 37ºC en incubadors de cultius amb un 5% de CO 2 i
un 90% d’humitat, controlant la viabilitat a cada replaqueig mitjançant tinció amb blau de
tripà (Merck Millipore). Tots els assaigs es van realitzar quan la línia cel·lular es trobava
entre un 80 i un 90% de confluència i amb una viabilitat superior al 90%. En el cas de la línia
THP1, que creix en suspensió, es va cultivar a una concentració d’entre 0.2 i 0.6 milions de
cèl·lules/ml.
Per a l’obtenció de medis condicionats, es van cultivar les cèl·lules d’interès en un
flascó de 25 cm 2 fins a una confluència del 80%. Posteriorment, es va substituir el medi de
cultiu per 5 ml de medi sense suplementar amb o sense l’estímul corresponent (S100A7 a 3
62
Materials i Mètodes
μM) i es va deixar durant 48 hores. A continuació, es va retirar el medi, es va centrifugar, es
va filtrar per 0.22 μm i es va congelar per al seu posterior ús. En el cas de la línia THP1, el
cultiu es va fer a una concentració de 0.4 milions de cèl·lules/ml i la sembra es va fer
directament en el medi sol amb o sense l’estímul corresponent.
Per a l’anàlisi de la secreció de S100A7 al sobrenedant, es van cultivar les cèl·lules
d’interès en un flascó de 25 cm 2 fins a una confluència del 80%. Posteriorment, el medi es
va substituir per 5 ml de medi complet fresc i es va deixar durant 24 hores per evitar la
presència de S100A7 a causa de la lisi cel·lular.
3.4. Tècniques de biologia molecular
3.4.1. Assaig d’interacció proteïna-receptor per ELISA
En base als estudis realitzats per Liu i altres (Liu et al., 2009), es va desenvolupar un
assaig d’interacció utilitzant la tècnica d’ELISA, per estudiar la unió de la proteïna S100A7 al
receptor RAGE i el bloqueig amb els anticossos obtinguts.
En concret, diferents concentracions de la proteïna S100A7 es van utilitzar com a
recobriment en plaques d’ELISA (Nunc TM MaxiSorp TM) en PBS-Ca2+/Zn2 +/Mg2 + (PBS amb
CaCl2 1 mM, ZnCl2 10 μM i MgCl2 0.5 m M), durant tota la nit a 4ºC. Després de rentar amb
PBS, els pous es van bloquejar amb PBS-Ca2+/Zn2 +/Mg2 + al 1% de BSA durant 2 h a
temperatura ambient. A continuació, diferents concentracions de la proteïna quimèrica
formada per la part extracel·lular del receptor RAGE i una cua d’IgG humana (RAGE-Fc,
R&D Systems) es van incubar en tampó de bloqueig durant 24, 48 o 72 h a 4ºC. El receptor
recombinant quimèric EGFR-Fc (R&D Systems) es va utilitzar com a control negatiu.
Després del temps d’incubació, es va rentar 3 cops amb PBS. Per detectar el receptor unit a
la proteïna S100A7, l’anticòs de cabra anti-IgG humana conjugada a HRP (Calbiochem) es
va incubar a dilució 1/12.500 en PBS-Ca2+/Zn2 +/Mg2 + al 0.2% de BSA, durant 2 h a 4ºC. Per
últim, es va afegir el substrat TMB i, després d’aturar la reacció amb HCl 1 M, es va realitzar
la lectura de la placa a 450 nm amb l’espectrofotòmetre Multiskan Ascent (Thermo). La unió
específica es va obtenir després de restar la densitat òptica (OD) obtinguda en absència de
proteïna al recobriment.
Per al bloqueig de la interacció, els 16 anticossos obtinguts contra la S100A7, a més
del 5C3 (anti-S100A4) i el 2H8 (anti-S100P) com a controls negatius, es van incubar sobre el
recobriment de S100A7 a 10 i 30 nM en tampó de bloqueig, durant 2 hores a temperatura
63
ambient. Després de rentar l’anticòs no unit, es va incubar el receptor tal com s’ha descrit. El
percentatge d'interacció es va calcular considerant la unió específica en absència d’anticòs
com el 100% d'interacció.
3.4.2. Sandwich ELISA
Per quantificar la proteïna present en el sobrenedant del cultiu cel·lular o bé en fluids
biològics com ara la sang, es va desenvolupar un sandwich ELISA amb els anticossos
obtinguts al laboratori, basat en la metodologia descrita prèviament (Hernandez et al., 2013).
Per a la selecció de la millor parella per formar el sandwich (anticòs de captura i
anticòs de detecció), els anticossos monoclonals anti-S100A7 2D9, 2H3, 6E3, 6F5, 8B6 i
9F3, es van biotinilar utilitzant ChromaLink TM Biotin Antibody Labeling Kit (Solulink TM) segons
les instruccions del fabricant.
El protocol definitiu utilitzat per al sandwich ELISA va ser el següent: es va recobrir la
placa d’ELISA (Nunc TM MaxiSorp TM) amb 50 μl/pou de l’anticòs 9F3 a 10 μg/ml durant tota la
nit a 4ºC. Després de rentar 2 cops amb PBS-HT, es va bloquejar amb 150 μl/pou de PBS al
1% de llet desnatada en pols durant 2 h a 37ºC. A continuació, es va incubar la recta patró
de proteïna recombinant S100A7 i les mostres a valorar (*) durant 2 h a 37ºC. Després de
rentar 5 cops, l’anticòs 2D9-biotinilat (subcontractat a GeneScript) es va incubar a 10 μg/ml
en tampó de bloqueig, durant 2 h a 37ºC. Es va rentar la placa 5 cops i es va incubar
l’estreptavidina conjugada a peroxidasa (Dako) a dilució 1/1000 en tampó de bloqueig,
durant 1 h a 37ºC. Per últim, es va rentar 5 cops i es va afegir el substrat TMB. Després
d’aturar la reacció amb HCl 1 M, es va llegir el senyal a 450 nm amb l’espectrofotòmetre
Multiskan Ascent (Thermo).
(*) El tampó d’incubació de la corba de S100A7 recombinant va dependre de la mostra a
analitzar. En els casos en què es va voler quantificar la presència de S100A7 en el sèrum,
les mostres es van diluir 1:1 amb PBS i la corba de S100A7 es va realitzar en PBS amb un
50% de FCS. En els casos en què es va voler analitzar la presència de S100A7 en el
sobrenedant de les cèl·lules, es van realitzar les dilucions necessàries de la mostra amb
medi de cultiu al 10% de FCS i la corba de S100A7 en va fer diluint la proteïna també en
medi de cultiu al 10% de FCS.
64
Materials i Mètodes
3.4.3. Estudi de l’expressió de proteïnes
3.4.3.1.
Extracció de proteïnes a partir de cultiu cel·lular o de teixit
Per a la seva posterior anàlisi per western blot, es van realitzar extraccions de
proteïnes tant de pellets cel·lulars o cultiu en placa com de teixit. En el cas dels pellets
cel·lulars, es va afegir un volum de tampó RIPA (Tris-HCl 50 mM, pH 7.4, 1% IGEPAL® CA630, EDTA 5 mM, NaCl 150 mM, PMSF 100 μg/ml, ortovonadat sòdic 1 mM i NaF 1 mM)
igual a dos cops el volum ocupat per les cèl·lules, mantenint en tot moment la mostra en gel.
Per a l’extracció de cultiu en placa es van afegir 30 μl de RIPA per a pous de 24 o 150 μl de
RIPA per a pous de 6 i es va rascar el fons de la placa per recollir tot el lisat. Després
d’agitar al vòrtex cada 10 minuts durant mitja hora, es va centrifugar a 16.000 G durant 10
minuts i el sobrenedant es va conservar a -20ºC.
En el cas de l’extracció a partir de teixit, es va afegir sobre la peça un volum de tampó
RIPA igual a 2 cops el volum aproximat del teixit i es va procedir a la lisi mecànica utilitzant
un Ultra-Turrax® T8 (IKA®), mantenint en tot moment el tub en gel. Un cop homogeneïtzat el
teixit, es va centrifugar a 16.000 G durant 10 minuts i el sobrenedant es va conservar
congelat a -20ºC.
3.4.3.2.
Quantificació de la concentració de proteïna
Després de l’extracció de les mostres, es va quantificar la concentració de proteïna
amb el reactiu de Bradford (Bio-Rad), utilitzant concentracions conegudes d’albúmina de
sèrum boví (BSA) (Sigma) com a recta patró (Noble and Bailey, 2009).
3.4.3.3.
Western blot
Entre 50 i 150 μg de proteïna provinent dels extractes totals es van resoldre sota
condicions reductores en gels d’electroforesi al 10-15% de SDS-poliacrilamida. En concret,
es va afegir tampó de càrrega 8X (Tris-HCl 0.25 M, pH 6.8, 8% SDS, 40% glicerol, 8% βmercaptoetanol i 0.04% blau de bromofenol) a l’extracte a analitzar, es va bullir durant 5
minuts a 95ºC i es va refredar en gel durant 5 minuts. Les mostres es van resoldre a 150 V
en tampó TGS (Tris 25 mM, Glicina 200 mM i 0.1% SDS). Posteriorment, es van transferir a
membranes de PVDF BioTraceTM (PALL corporation) en tampó de transferència (Tris-HCl 25
mM, pH 7.6, glicina 200 mM i 20% metanol) durant 1 hora a 350 mA i 4ºC. Per visualitzar
l’èxit de la transferència, les membranes es van tenyir amb vermell de Ponceau (0.1%
vermell de Ponceau S (Merck Millipore) en àcid acètic 1%). Per últim, es van bloquejar
durant 1 hora en TBS-Tween (Tris-HCl 50 mM, pH 7.4, NaCl 150 mM i 0.1% Tween-20) amb
65
un 5% de llet desnatada en pols o bé amb el tampó de bloqueig recomanat pel fabricant de
l’anticòs primari.
3.4.3.4.
Immunodetecció
Després de bloquejar, les membranes es van incubar amb l'anticòs primari en les
condicions indicades a la Taula 1.
Taula 1. Anticossos utilitzats per western blot i condicions d’incubació.
Anticòs primari
Proveïdor
Clon
Font
Dilució
Pes molecular
S100A7 humana
Imgenex
47C1068
Ratolí
2 μg/ml
12 KDa
S100A7 humana
LEITAT
9F3
Ratolí
2 μg/ml
12 KDa
S100A7 murina
Antibodies-online
--
Conill
2 μg/ml
12 KDa
S100A4 humana/murina
LEITAT
5C3
Ratolí
1 μg/ml
12 KDa
RAGE
Millipore
mAbA11
Ratolí
2.5 μg/ml
48 KDa
HIF1α
BD Biosciences
54/HIF-1α
Ratolí
1 μg/ml
120 KDa
p44/42 (ERK1/2)
Cell Signaling
--
Conill
1/1000
42, 44 KDa
Phospho-p44/42 (ERK1/2)
Cell Signaling
E10
Ratolí
1/2000
42, 44 KDa
p38
Cell Signaling
--
Conill
1/1000
43 KDa
phospho-p38
Cell Signaling
28B10
Ratolí
1/1000
43 KDa
p54/46 (SAPK/JNK)
Cell Signaling
--
Conill
1/1000
46, 54 KDa
phospho-p54/46 (SAPK/JNK)
Cell Signaling
G9
Ratolí
1/1000
46, 54 KDa
β-actina HRP
Sigma
AC-15
Ratolí
1/25000
42 KDa
Anticòs secundari
Proveïdor
Font
Dilució
Ratolí HRP
Jackson
Cabra
1/50000
Conill HRP
Jackson
Cabra
1/50000
A continuació, les membranes es van rentar 3 cops durant 10 minuts amb TBS-Tween
i es van incubar amb l’anticòs secundari corresponent, durant 1 hora a temperatura ambient.
Després de rentar, les membranes es van incubar amb el substrat del kit ECLTM Western
Blotting Detection Reagents (Amersham), es van exposar en pel·lícules Hyperfilm TM ECL
(Amersham) durant el temps necessari i es van revelar al revelador automàtic
HYPERPROCESSOR (Amersham).
Per últim, els films es van escanejar i es van quantificar les bandes amb el programa
NIH ImageJ (National Institutes of Health, Bethesda, Maryland, USA), utilitzant el valor de la
β-actina per normalitzar la quantitat de proteïna carregada.
66
Materials i Mètodes
3.4.4. Immunocitoquímica
La tècnica d’immunocitoquímica (ICQ) es va realitzar sobre cambres de vidre estèrils
(Lab-Tek®II Chambre Slide™ System) tractades amb PBS al 1% de BSA, durant 30 minuts
a 37ºC. Dues-centes mil cèl·lules de la línia cel·lular MDA-MB-468 es van sembrar en cada
cambra en medi complet i es van deixar adherir durant 24 h a l’incubador. La monocapa de
cèl·lules es va rentar 3 cops amb PBS, es va fixar amb metanol fred durant 2 minuts a -20ºC
i es va tornar a rentar 3 cops amb PBS i 2 cops durant 5 minuts amb PBS-G (PBS amb
glicina 20 mM) a temperatura ambient. A continuació, es van bloquejar les unions
inespecífiques amb solució de bloqueig (PBS amb glicina 20 mM, 2% de BSA i 5% de FCS)
durant 20 minuts a temperatura ambient. Per detectar la proteïna S100A7 , es va incubar
l’anticòs 9F3 a una concentració de 5 μg/ml en solució de bloqueig durant tota la nit a 4ºC,
mantenint els vidres en una cambra humida. Després de rentar amb PBS-G, es va afegir
l’anticòs secundari de cabra anti-IgG murina (H+L) conjugat a Alexa Fluor® 488 (Jackson),
diluït 1/300 en solució de bloqueig, i es va incubar durant 1 hora a 37ºC en cambra humida i
a les fosques. A continuació, els vidres es van rentar 2 cops durant 5 minuts amb PBS i es
van tenyir els nuclis amb Bisbenzimide Hoechst 33342 (Sigma) a dilució 1/1000 en PBS
durant 10 minuts a temperatura ambient i en cambra humida a les fosques. Després d’un
últim rentat amb PBS, es van desmuntar les cambres dels vidres i es van cobrir les
preparacions utilitzant Mowiol® (Sigma) com a medi de muntatge. Els resultats es van
analitzar al microscopi invertit Leica DM-IRBE i es van prendre imatges a 200 augments
utilitzant el programa MetaMorph®.
En el cas dels assaigs d’elevada confluència amb la línia cel·lular A431, es va sembrar
1 milió de cèl·lules a cada cambra. Un cop es va arribar a una confluència del 100%, es van
mantenir en cultiu durant 23 dies, canviant el sobrenedant per medi complet fresc cada 3-4
dies. Com a temps 0 (cèl·lules no sotmeses a elevada confluència) es van utilitzar cèl·lules
de A431 sembrades 24 h abans de fer la tinció. Posteriorment, es va realitzar la tinció
d’immunocitoquímica tal com s’ha descrit anteriorment.
3.4.5. Array de citoquines
Per realitzar l'anàlisi de les citoquines secretades en resposta a la proteïna S100A7,
les línies cel·lulars A431 (200.000 cp), THP1 (400.000 cèl·lules/ml), BJ (50.000 cp) i HUVEC
(150.000 cp) es van sembrar en pous d'una placa de 24 (Nunc). Excepte la línia monocítica,
les cèl·lules es van sembrar en 500 μl de medi complet. A les 24 hores es van rentar els
pous amb 1 ml de medi sol i es van afegir 300 μl/pou de medi sol amb 3 μM de S100A7 o bé
13.5 ng/ml de LPS (control basal). Per a la línia endotelial HUVEC va ser necessari recobrir
67
els pous amb gelatina al 1% durant 1 hora abans de sembrar les cèl·lules. Els monòcits
THP1 es van sembrar directament en 300 μl/pou de medi sol amb l’estímul corresponent.
Després de 48 hores d’estímul, es van recollir els sobrenedants de les cèl·lules i es van
centrifugar a 16.000 G per eliminar possibles restes cel·lulars. En el cas de les THP1, primer
es va fer una centrifugació a 1.400 rpm per eliminar les cèl·lules en suspensió i es va recollir
el sobrenedant per centrifugar-lo a màxima revolució. Un cop obtinguts els sobrenedants, es
van congelar a -20ºC fins al seu ús.
Es va utilitzar el kit de citoquines RayBio® C-Series Human Angiogenesis Array 1000,
que detecta 43 citoquines (separades en 2 membranes: C1 i C2) relacionades amb
processos d'angiogènesi i moviment cel·lular. Les 4 membranes de cada línia cel·lular (C1 i
C2 basal i C1 i C2 S100A7) es van revelar alhora utilitzant el lector de luminescència LAS3000 (Fujifilm) amb càmera CCD acoblada. Les imatges obtingudes es van quantificar
utilitzant el programa NIH ImageJ (National Institutes of Health, Bethesda, Maryland, USA) i
la intensitat de es va normalitzar utilitzant els controls positius presents a cada membrana.
Per determinar l'increment o descens en la secreció de cada citoquina, la intensitat
normalitzada del medi estimulat amb S100A7 es va dividir per la intensitat normalitzada del
medi basal (LPS).
3.4.6. Zimografia en gelatina
Per realitzar l'anàlisi de les metal·loproteïnases secretades en resposta a S100A7, els
sobrenedants de les cèl·lules es van obtenir tal com es detalla a l’apartat anterior per a les
línies HUVEC i THP1. L’estímul es va fer durant 24, 48 o 72 hores amb S100A7 (0.1, 0.3, 1,
3 o 10 μM) en el medi corresponent sense suplementar. En el cas de la HUVEC, a més, es
va testar l’efecte de la combinació de S100A7 (3 μM) amb VEGF (10 ng/ml), a les 48 hores
d’estímul. Per a la línia THP1 es va realitzar, a més, un estímul dosi-resposta amb LPS (0.4,
1.3, 4.5, 13.5 i 45 ng/ml) durant 48 hores. En alguns casos, la proteïna S100A7 (3 μM) es va
preincubar amb els anticossos anti-S100A7 (9 μM), durant 2 hores a 37ºC abans d’afegir-la
a les cèl·lules, i l’estímul va continuar durant 48 hores.
L’anàlisi per zimografia es va realitzar tal com s’ha descrit prèviament (Bourd-Boittin et
al., 2005) amb modificacions. En concret, entre 5 i 10 μl del sobrenedant de les cèl·lules es
van barrejar amb el mateix volum de tampó de càrrega sense agents reductors (Tris-HCl 80
mM, pH 6.8, 4% SDS, 10% glicerol i 0.01 % blau de bromofenol) i es van resoldre en un gel
al 8% de SDS-poliacrilamida copolimeritzat amb gelatina de pell de porc de tipus A (Sigma)
a una concentració de 1 mg/ml. Després, el gel es va rentar a temperatura ambient 1 cop
durant 5 minuts en aigua destil·lada i 3 cops durant 15 minuts en solució renaturalitzant
68
Materials i Mètodes
(2.5% Tritó-X100). A continuació, es va incubar el gel en tampó de zimografia (Tris-HCl 50
mM, pH 7.5, CaCl2 10 mM i 0.02% NaN3) durant 24 hores a 37ºC. Acabat el temps
d’incubació, es va tenyir durant 1 hora a temperatura ambient amb tampó de tinció (àcid
acètic, metanol i aigua destil·lada (ddH2O) en proporció 1:3:6 i 0,1% naphtol amido black
(Sigma)) i es va destenyir (àcid acètic, metanol i ddH2O en proporció 1:3:6) fins que es van
observar les bandes corresponents a l’activitat proteolítica de les metal·loproteïnases
presents (bandes clares sobre fons fosc). Finalment, es va escanejar el gel i es van
quantificar les bandes fent servir el programa NIH ImageJ (National Institutes of Health,
Bethesda, Maryland, USA).
3.4.7. Estudi de la secreció de GM-CSF per ELISA
L'anàlisi de la secreció de la proteïna GM-CSF (de l’anglès Granulocyte-Macrophage
Colony-Stimulating Factor) es va dur a terme utilitzant el Human GM-CSF ELISA kit
(Thermo) seguint les instruccions del fabricant.
El sobrenedant de les cèl·lules es va obtenir tal com es detalla a l’apartat 3.4.5 per a
les línies HUVEC, THP1, BJ i A431. L’estímul es va fer durant 48 hores amb S100A7 (3 μM)
o LPS (13.5 ng/ml) en el medi corresponent sense suplementar.
Per a l’estudi de la via de senyalització implicada en la secreció de GM-CSF, les
cèl·lules es van preincubar durant 2 hores a 37ºC amb els inhibidors que es mostren a la
Taula 2. Després, es va afegir la S100A7 a 3 μM i l’estímul va continuar durant 48 h.
Taula 2. Inhibidors químics utilitzats per a l’estudi de la via de senyalització.
Inhibidor
Diana
Concentració de treball
PD098059
MAPKK
20 μM
Calbiochem
SB202190
MAPK p38 isoformes α i β
20 μM
Sigma
SP600125
c-Jun N-terminal kinase (JNK)
20 μM
Sigma
MK-2206
Akt1, Akt2 i Akt3
1 μM
Santa Cruz
BAY 11-7082
IKK1 i IKK2
20 μM
Sigma
SB202474
Sense diana
20 μM
Calbiochem
69
Casa comercial
3.5. Estudis in vitro
3.5.1. Assaig de proliferació
L’efecte de la proteïna S100A7 sobre la proliferació cel·lular es va estudiar per MTT
segons es va descriure prèviament (Ning et al., 2007), amb modificacions. Aquest mètode es
basa en la reducció del MTT (3-(4,5-Dimethylthiazol-2-yl)-2,5-Diphenyltetrazolium Bromide),
o sals de tetrazoli, a cristalls de formazan via l’enzim mitocondrial succinat deshidrogenasa,
actiu en les cèl·lules vives (Cole, 1986). En concret, les línies tumorals MDA-MB-231, MDAMB-468, A431 (3.000 cp), la línia endotelial HUVEC (10.000 cp), la línia monocítica THP1
(5.000 cp) i la línia fibroblàstica BJ (5.000 cp) es van sembrar en plaques de 96 pous, en 100
μl de medi al 1% o al 3% de FCS i en presència de 0, 10, 100 o 1000 nM de S100A7 i es
van deixar créixer durant 24, 48 o 72 hores. El valor obtingut dels pous al 0% de viabilitat es
va considerar com a control negatiu (soroll de fons). Els valors obtinguts amb medi complet
es va considerar com a màxim de proliferació (control positiu). En el cas de la HUVEC, va
ser necessari recobrir la placa amb gelatina al 1%. Per tenir el valor d’absorbància a temps 0
de proliferació, es va revelar una placa immediatament després de ser sembrada.
Acabat el temps d’estímul es va procedir a la tinció de les cèl·lules viables. Primer, es
van afegir 10 μl/pou de SDS al 1% en els pous del control negatiu per lisar les cèl·lules i es
va deixar 5 minuts a l'incubador de cultius. Posteriorment, es van afegir 10 μl/pou de reactiu
MTT (Calbiochem) a 5 mg/ml en PBS, i es va deixar a l'incubador durant 3 hores. Passat el
temps de tinció, es van afegir 100 μl/pou de tampó d’extracció (50% dimetilformamida al
50% en ddH2O i 15% SDS) i es va deixar durant 1 hora a 37ºC. Finalment, es van
homogeneïtzar els pous i es va llegir l’absorbància a 570 nm amb l’espectrofotòmetre
Multiskan Ascent (Thermo). El valor d’absorbància corresponent al control negatiu es va
restar a la resta de condicions.
En un altre tipus d’experiment, es van sembrar cèl·lules de la línia A431 (3.000 cp) en
100 μl de medi complet. A les 24 hores, es va retirar el medi complet i es va substituir pels
medis condicionats de la línia THP1, HUVEC o BJ. Els medis condicionats amb o sense
S100A7 a 3 μM es van obtenir tal com es detalla a l’apartat 3.3, després de 48 hores. La
proliferació de la línia A431 en resposta als medis condicionats es va seguir durant 24, 48 i
72h.
70
Materials i Mètodes
3.5.2. Assaig d’adhesió
Per estudiar si la proteïna S100A7 funciona com a proteïna d’adhesió per a diferents
tipus cel·lulars es va utilitzar un protocol descrit prèviament (Humphries, 2009), amb
modificacions. En concret, la proteïna S100A7 es va utilitzar com a recobriment sobre
plaques de cultiu Costar™ 96-Well EIA/RIA Plates a una concentració de 10 μM fins a 9.7
nM fent dilucions 1:2 en PBS estèril (50 μl/pou). Després de tota la nit a 4ºC, es van rentar
amb PBS i es van bloquejar els pous amb PBS al 1.5 % de BSA (100 μl/pou) durant 1 h a
37ºC. A continuació, es van plaquejar les cèl·lules de la línia MDA-MB-231 (40.000 cp),
MDA-MB-468 (40.000 cp), A431 (80.000 cp), HUVEC (40.000 cp), THP1 (100.000 cp) o BJ
(12.000 cp) en 100 μl/pou de medi sol amb un 1.5% de BSA i es van deixar adherir durant 4
hores.
El nombre de cèl·lules adherides sobre la matriu de S100A7 es va valorar utilitzant un
assaig colorimètric basat en l’enzim hexosaminidasa (Landegren, 1984). En concret, es va
retirar el sobrenedant i es van rentar les cèl·lules no adherides dos cops amb PBS-Ca2+/Mg 2+
(PBS amb CaCl2 1 mM i MgCl2 0.5 mM) abans d’afegir 60 μl/pou de tampó substrat (7.5 mM
de p-nitrofenol-N-acetyl-β-D-glucosaminida (Sigma), 0.1 M de citrat sòdic i 0.25% de Tritó X100 en ddH2O, pH 5). Després de 2-3 h a 37ºC es va aturar la reacció amb 90 μl/pou de
tampó revelador (Glicina 50 mM i EDTA 5 mM en ddH2O, pH 10.4). L’absorbància de cada
pou es va llegir a 405 nm amb l’espectrofotòmetre Multiskan Ascent (Thermo).
La densitat òptica mitjana obtinguda en els pous sense cèl·lules (soroll de fons) es va
restar a la resta de pous. Es va considerar com a 100% d’adhesió el màxim valor
d’absorbància obtingut en presència de S100A7.
3.5.3. Assaig de migració
3.5.3.1.
Migració de cèl·lula tumoral, endotelial i fibroblast
Per valorar l’efecte de la S100A7 sobre la migració cel·lular es va seguir el protocol
descrit prèviament (Hernandez et al., 2013), amb modificacions. Es van utilitzar plaques de
cultiu de 24 pous amb inserts de filtres de membrana PET opacs a la llum i porus de 8 μm
(Transwell HTS FluoroBlok TM Multiwell Insert System, Becton Dickinson). Primer, es van
recobrir les dues cares de la membrana durant 1 hora a 37ºC amb col·lagen tipus I a 15
μg/ml (Upstate) en PBS estèril. A continuació, les línies tumorals MDA-MB-231 (50.000 cp),
MDA-MB-468 (100.000 cp), A431 (100.000 cp), la línia endotelial HUVEC (50.000 cp) i la
línia de fibroblast BJ (20.000 cp) es van sembrar en 100 μl del medi corresponent sense
71
suplementar al compartiment superior de les cambres de migració. Immediatament després,
es va afegir al compartiment inferior el medi sol amb l’estímul corresponent (500 μl/pou) i es
va deixar la placa a l’incubador de cultius durant 24 hores. En el cas de la línia tumoral MDAMB-468, va ser necessari utilitzar medi al 0,1% de FCS tant al compartiment superior com a
l’inferior, per facilitar la migració. Passat el temps d’incubació, es va substituir el medi del
compartiment inferior per medi complet amb Calceïna-AM (Calbiochem) a 5 μM i es va
deixar la placa a 37ºC durant 20 minuts. Les cèl·lules adherides a la cara inferior de la
membrana es van fotografiar amb un microscopi invertit de fluorescència (Leica) a 100
augments. El nombr de cèl·lules migrades es va quantificar per recompte manual. En el cas
de la línia tumoral A431, el recompte es va fer considerant la superfície ocupada per
cèl·lules respecte de la superfície total, utilitzant el programa NIH ImageJ (National Institutes
of Health, Bethesda, Maryland, USA).
Per estudiar l’efecte migratori de la S100A7 es van utilitzar concentracions de 0.3, 1 i 3
μM de proteïna. A més, en el cas de la HUVEC, es va analitzar l’efecte de la combinació de
1 μM de S100A7 amb 10 ng/ml de VEGF-165 (Isokine). El nombre de cèl·lules migrades en
presència de medi complet es va considerar com el màxim de migració (control positiu). Tots
els valors es van normalitzar respecte de la migració basal (medi sol sense estímul) que es
va considerar el 100% de migració.
Per al bloqueig de l’efecte de la S100A7 es van utilitzar els anticossos monoclonals
obtinguts. En contret, la S100A7 es va preincubar durant 2 hores a 37ºC amb l’anticòs
corresponent a una concentració 3 cops superior a la de la proteïna, abans de posar
l’estímul a la placa. En aquest cas, com a 100% de migració es va considerar el valor de
l’efecte induït per la S100A7 després de restar-li el valor basal (medi sense estímul).
3.5.3.2.
Migració de monòcits
En el cas de la migració de cèl·lula en suspensió, com és la THP1, es va seguir el
protocol descrit anteriorment (Tsai et al., 2008), amb modificacions. En concret, es van
utilitzar plaques de cultiu de 96 pous amb inserts de filtres de membrana de poliester i porus
de 8 μm (HTS Transwell® well permeable supports, Corning). Com s’ha explicat a l’apartat
anterior, les membranes es van recobrir per les dues cares amb col·lagen tipus I a 15 μg/ml.
A continuació, les cèl·lules es van sembrar (50.000 cp) al compartiment superior en 50 μl de
medi sol. Immediatament després, es va afegir al compartiment inferior el medi amb l’estímul
corresponent (150 μl/pou) i es va deixar la placa a l’incubador de cultius durant 4 hores. Les
cèl·lules migrades al compartiment inferior es van resuspendre i es van comptar amb la
cambra de neubauer.
72
Materials i Mètodes
Per estudiar l’efecte migratori de la S100A7 es va utilitzar la proteïna recombinant a
diferents dosis (1, 3 i 10 μM). El LPS a la concentració de 13.5 ng/ml es va utilitzar com a
control per determinar la migració induïda per les endotoxines presents en la proteïna
recombinant. A més, es va estudiar l’efecte de la polimixina B (Sigma) a 100 μg/ml, un
inhibidor del LPS (Cardoso et al., 2007), sobre la migració induïda per la S100A7 (3 μM) o el
LPS (13.5 ng/ml). El nombre de cèl·lules migrades en presència de medi complet es va
considerar com el màxim de migració (control positiu). Tots els valor es van normalitzar
respecte de la migració basal (medi sol sense estímul) que es va considerar el 100% de
migració.
Per al bloqueig de l’efecte de la S100A7 (3 μM), es va preincubar la proteïna amb 9
μM de cada anticòs anti-S100A7, durant 2 hores a 37ºC. En aquest cas, com a 100% de
migració es va considerar el valor de l’efecte induït per la S100A7 després de restar-li el
valor basal (medi sense estímul).
3.5.4. Assaig de wound healing
Per estudiar l’efecte de la S100A7 sobre la mobilitat de la cèl·lula endotelial HUVEC es
van utilitzar assaigs de reparació de ferida o wound healing seguint el protocol descrit
prèviament (Lam et al., 2008), amb modificacions. En concret, es van sembrar 50.000 cp en
100 μl de medi EBM complet en plaques de 96 pous amb recobriment de gelatina al 1% i es
van deixar adherir durant tota la nit a l’incubador. Al dia següent, es va retirar el medi
complet i, després de realitzar 2 rentats amb medi sol, es van afegir 100 μl/pou de medi
EBM sense suplementar. Després de 20 hores de deprivació, es va retirar el sobrenedant i
es va practicar una ferida sobre la monocapa de cèl·lules d’aproximadament 1 mm
d’amplada amb una punta de pipeta. Després de rentar els pous per retirar les cèl·lules
desadherides, es van afegir 100 μl/pou de medi EBM sense suplementar amb S100A7 a 0,
0.3, 1 i 3 μM, a més d’EBM al 10% de FCS com a control positiu. Per al bloqueig de l’efecte
de la S100A7, 1 μM de proteïna es va preincubar amb 3 μM dels anticossos anti-S100A7
(2D9, 2H3, 6E3, 6F5, 8B6 i 9F3) durant 2 h a 37ºC abans d’afegir-lo a les cèl·lules.
Es va realitzar una fotografia a 100 augments del centre de la ferida de cadascun dels
pous a les 0 i a les 24 hores d’estímul. Utilitzant el programa NIH ImageJ (National Institutes
of Health, Bethesda, Maryland, USA) es va quantificar l’àrea de la ferida de cada pou a
temps 0 (àrea inicial) i a les 24 hores (àrea final), considerant l’àrea inicial com el 100% de
superfície. Per quantificar el percentatge de reparació obtingut es va utilitzar la següent
fórmula:
73
ª àrea final
º
u 100»
Reparació de la ferida (%) = 100 - «
àrea
inicial
¬
¼
El percentatge de reparació de la ferida obtingut en la condició de 0 μM de S100A7 es
va considerar com el 100%, per tal de valorar l’increment induït per la proteïna i el bloqueig
amb els anticossos.
3.5.5. Assaig d’adhesió de cèl·lula immune a cèl·lula endotelial
Per analitzar si la proteïna S100A7 indueix l’adhesió de la cèl·lula immunitària (en
aquest cas, el monòcit THP1) sobre la cèl·lula endotelial (HUVEC), es va utilitzar el protocol
descrit anteriorment (Hung et al., 2008), amb modificacions. En concret, la línia cel·lular
HUVEC es va sembrar, sobre recobriment de gelatina al 1%, a raó de 50.000 cp en plaques
de 96 pous i en 100 μl de medi EBM complet. A les 24 hores, es van rentar els pous amb
medi sense suplementar i es van posar 100 μl/pou de medi sol amb els estímuls
corresponents (S100A7 a 0.1, 1 i 10 μM o LPS a 1, 10 i 100 ng/ml). Després de 48 hores
d’estímul, es va rentar la monocapa de HUVEC amb medi sense suplementar i es van afegir
els monòcits prèviament marcats (Calceïna-AM (5 μM) durant 30 minuts a 37ºC) a raó de
20.000 cp en 100 μl de medi sol. Es va deixar la placa durant 1 hora a l’incubador, i,
posteriorment, es van rentar els pous 3 cops amb medi sol per eliminar les cèl·lules
monocítiques no adherides a la monocapa de HUVEC. Per últim, es va llegir la intensitat de
fluorescència amb el lector de plaques Fluoroskan Ascent (Thermo) a una longitud d’ona
d’excitació/emissió de 485/538 nm.
En un segon tipus d’experiment, la monocapa de HUVEC es va rentar a les 24 hores
d’haver-les sembrat i es van afegir les cèl·lules THP1 marcades (20.000 cp en 100 μl/pou),
en presència dels estímuls corresponents (S100A7 a 0.1, 1 i 10 μM o LPS a 1, 10 i 100
ng/ml). En aquest cas, el temps d’adhesió va ser de 4 hores i es van quantificar les cèl·lules
adherides tal com s’ha explicat anteriorment.
3.6. Estudis in vivo
3.6.1. Animals d’experimentació i condicions d’estabulació
En els estudis in vivo realitzats en aquest treball es van utilitzar ratolins femella atímics
de la soca Hsd:Athymic Nude-Foxn1nu (Harlan Laboratories) i ratolins femella de la soca
BALB/cAnNHsd (Harlan Laboratories), de 4-6 setmanes d’edat i de 20-22 g de pes a l’inici
74
Materials i Mètodes
de l’estudi. Els animals es van mantenir sota condicions d’esterilitat a una temperatura
constant de 20-22ºC i amb cicles diaris de llum/foscor de 12 hores. La seva manipulació es
va realitzar en cabines de flux laminar i tant les gàbies com els encenalls es va esterilitzar
prèviament, així com l’aigua i el menjar, que se’ls hi va proporcionar ad libitum.
Tots els procediments per a la manipulació d’animals d’experimentació van ser
aprovats pel Comitè Ètic d’Experimentació Animal del Parc Científic de Barcelona
(Plataforma de Recerca Aplicada en Animal de Laboratori) i pel comitè ètic de les autoritats
catalanes d’acord amb les lleis que regulen l’ús d’animals d’experimentació: procediment per
al model de tumor xenoempelt subcutani (Número: DAAM-6038) i procediment per a la
immunització de ratolins (Número: DAAM-5883).
3.6.2. Estudis de creixement tumoral
3.6.2.1.
Caracterització del creixement subcutani in vivo de la línia A431
Trenta ratolins femella atímics, prèviament identificats amb un xip, es van anestesiar
per inhalació d’isoflurà i es van punxar subcutàniament al costat dret amb 4 milions de
cèl·lules de la línia tumoral A431 (100 μl de medi sol a 40 milions de cèl·lules/ml), utilitzant
una agulla de 25G.
El seguiment del volum tumoral es va fer 3 cops per setmana a partir del tercer dia
després de la inoculació. Amb l’ajuda d’un peu de rei, es va mesurar el diàmetre llarg (D) i el
diàmetre curt (d) del tumor i es va calcular el volum d’acord amb la fórmula d’una l’el·lipse
allargada:
Volum tumoral (mm3 ) =
D u d2
2
Animals amb volums tumorals des de 20 fins a 1000 mm 3 es van sacrificar per asfixia
amb CO 2 i es va extreure tant la sang (per punció cardíaca, sense anticoagulants) com els
tumors sencers, tal com s’explica a l’apartat 3.6.4, per a la seva posterior anàlisi.
Per tal de valorar l’efecte de la presència i absència de tumor sobre els nivells de
S100A7 en sang, tres ratolins amb volums tumorals de 740, 828 i 943 mm 3 es van sotmetre
a cirurgia per reseccionar el tumor. Just abans de l’operació es va extreure sang de cada
ratolí per punció a la vena facial. Després d’anestesiar-los per via intraperitoneal amb una
barreja de ketamina (90 mg/kg) / xilacina (4.5 mg/kg), es va extirpar el tumor amb l’ajuda
d’un bisturí i un cauteritzador. La incisió practicada a la pell es va tancar amb grapes. A les
75
72 hores de l’operació, els animals es van sacrificar i es va extreure la sang per punció
cardíaca.
D’altra banda, per tal de comprovar que els anticossos anti-S100A7 amb els que es
tractaran els ratolins, arribaven al tumor i, per tant, podien bloquejar la funció de la S100A7,
4 ratolins amb volums tumorals de 933, 780, 220 i 210 mm 3 es van tractar 3 cops durant 1
setmana per via intraperitoneal (1010100) amb 500 μg/dosis de l’anticòs anti-S100A7 2D9biotinilat. Posteriorment, els ratolins es van sacrificar i els tumors es van conservar per a la
seva posterior anàlisi.
3.6.2.2.
Estudi d’eficàcia dels anticossos anti-S100A7
Per a l’anàlisi de l’eficàcia dels anticossos anti-S100A7 es va utilitzar el model
subcutani de la línia A431. Tal com s’ha explicat a l’apartat anterior, es van inocular 4 milions
de cèl·lules/animal al costat dret de 110 ratolins atímics. Cinc dies després de la injecció, es
va començar a fer el seguiment del volum tumoral i el pes dels animals, que va continuar 3
cops per setmana al llarg de tot l’experiment.
A dia 8 i dia 12 de creixement es va sacrificar un animal i se li va extreure el tumor per
confirmar que hi havia expressió de S100A7 per western blot (120 i 80 mm 3 de volum,
respectivament). Quan la mitjana del volum tumoral va arribar a 130 mm 3 (excloent aquells
tumors que no havien crescut en les dues mesures prèvies), es va realitzar la selecció i el
repartiment dels animals en 7 grups de 10 animals cadascun. Per fer aquesta distribució, es
van ordenar els animals en funció del seu volum i es van anar adjudicant a cada grup en
ordre descendent i després en ordre ascendent fins que tots els grups van tenir 10 animals.
D’aquesta manera, la mitjana del volum tumoral de cada grup va ser pràcticament idèntica.
Després, es va adjudicar a l’atzar el tractament que rebria cada grup.
El mateix dia de l’agrupació, es va iniciar el tractament dels animals, que van rebre 100
μl del vehicle (PBS), en el cas del grup control, o bé 500 μg d’anticòs anti-S100A7 (2D9,
2H3, 6E3, 6F5, 8B6 o 9F3) a una concentració de 5 mg/ml en PBS estèril. L’administració es
va realitzar per via intraperitoneal 3 cops per setmana (1010100), i el seguiment del volum
tumoral i del pes dels animals va continuar fins al final de l’assaig (dia 30 de tractament).
Per al seguiment de l’efecte del tractament sobre el volum del tumor, es va utilitzar el
paràmetre de Relative Tumor Volume (RTV), que indica el percentatge de creixement del
tumor respecte del volum a l'inici del tractament (considerat com el 100%), de manera que:
RTV (%) =
Volum tumoral a dia determinat
u 100
Volum a l'inici del tractament
76
Materials i Mètodes
D’altra banda, quan la mitjana del volum tumoral dels animals que no van entrar al
primer estudi va arribar a 300 mm 3 (excloent aquells animals amb tumors que no havien
evolucionat de manera correcta), es va realitzar un segon repartiment en 2 grups de 10
animals, els qual van rebre tractament amb PBS (vehicle) o amb l’anticòs 6F5, seguint la
mateixa pauta i dosi que al primer estudi. El seguiment del volum tumoral i del pes dels
animals va continuar fins al final de l’assaig (dia 21 de tractament).
Al final dels estudis descrits, es van sacrificar els animals per asfixia amb CO 2 i es va
procedir a la recol·lecció de la sang i del tumor, per a la seva posterior anàlisi (vegeu apartat
3.6.4).
3.6.3. Estudi de metàstasi experimental
Per a l’anàlisi de l’efecte de la S100A7 sobre la preparació del nínxol premetastàtic es
va utilitzar un model de metàstasi hepàtica experimental descrit anteriorment (Wai et al.,
2005), injectant intraesplènicament cèl·lules de la línia tumoral murina de càncer de còlon
CT26.
Vint ratolins immunocompetents femella de la soca BALB/c es van separar en 2 grups
de 10 i es van administrar durant 1 setmana amb 100 μl de vehicle (PBS) o 100 μg de
proteïna recombinant S100A7 a 1 mg/ml en PBS estèril. L’administració es va realitzar per
via intraperitoneal de manera diària (1111111). A dia 2 de tractament es va extreure sang de
cada ratolí per punció a la vena facial. A dia 7, es va aturar el tractament i es van inocular les
cèl·lules tumorals de la següent manera: després d’anestesiar els animals per via
intraperitoneal amb una barreja de ketamina (90 mg/kg) / xilacina (4.5 mg/kg) es va rasurar i
desinfectar el costat esquerre i es va practicar una incisió d'un centímetre a través de la qual
es va poder extreure lleugerament la melsa, junt amb el pàncrees, amb l’ajuda d’unes
pinces. Es van injectar directament dins la melsa 20 μl de medi de cultiu amb les cèl·lules
CT26 a una concentració de 2.5 x 106 cèl·lules/ml (50.000 cèl·lules/animal). Després
d’esperar durant 1 minut sense extreure l’agulla de la melsa per evitar la fuita de cèl·lules, es
va practicar una esplenectomia amb l’ajuda d’un cauteritzador. Finalment, es va retornar el
pàncrees a la cavitat peritoneal, es va tancar el peritoneu amb fil de sutura no absorbible i es
va grapar la incisió practicada a la pell. El seguiment del pes dels animals es va fer al llarg
de tot l’estudi.
Als 21 dies després de la injecció de les cèl·lules, es van sacrificar els animals per
asfixia amb CO2 i es va procedir a la recol·lecció de mostres. Es va extreure la sang per
punció cardíaca i es va obrir la cavitat peritoneal per explorar la presència de metàstasis
77
hepàtiques. Es van extreure els fetges i es va fer un recompte del nombre i mida (entre 0.5 i
>5 mm de diàmetre) de les metàstasis visibles a tots els lòbuls. Després de fotografiar-los,
els fetges es van incloure en parafina per a la seva posterior anàlisi tal com es detalla a
l'apartat 3.6.4. per als tumors subcutanis.
3.6.4. Obtenció de mostres
L’obtenció de sèrum es va realitzar de dues maneres: 1) es va extreure sang dels
animals per punció a la vena facial amb una agulla de 20G i es va recol·lectar per
capil·laritat amb tubs Microvette® (Sarstedt) sense anticoagulant. 2) Al final de cada
experiment, es va extreure la sang dels animals per punció cardíaca amb agulla de 25G,
sense anticoagulant. A continuació, es va centrifugar la sang a 4.000 rpm durant 10 minuts i
el sèrum obtingut es va congelar per a la seva posterior anàlisi.
Els tumors subcutanis obtinguts es van extirpar, fotografiar i processar tal com
s’explica a continuació (Figura 1).
Parafina
OCT
WB
T
N
Vista transversal
Vista lateral
Figura 1. Esquema de l’obtenció de mostres a partir del tumor subcutani.
A la vista lateral es mostren els talls trans vers als que es van practicar en els tumors per
a la seva posterior anàlisi per western blot (WB), immunohistoquímica en parafina i
immunohistoquímica en teixit fresc (OCT). A la vista trans versal, es mostra un esquema
de l'int erior dels tumors, amb un centre de teixit necròtic (N), envoltat per teixit viu (T).
De cada tumor, es va reservar una porció, que es va submergir en metilbutà fred i es
va guardar en un tub a -80ºC per al seu anàlisi per western blot. D’altra banda, es va posar
una porció en un casset (Simport) que es va submergir en formaldehid durant 2 hores a
temperatura ambient i després en etanol 70% a 4ºC fins a la seva inclusió en parafina. Per
últim, una porció de tumor es va col·locar en un motlle, es va cobrir amb OCT (Tissue Tek®,
Sakura) i es va congelar a -80ºC.
78
Materials i Mètodes
La inclusió en parafina dels teixits es va realitzar al Servei d’histologia del Parc
Científic de Barcelona.
3.6.5. Anàlisis per immunohistoquímica
3.6.5.1.
Anàlisi de la vasculatura tumoral
El tumors immersos en OCT i congelats es van tallar en crioseccions de 5 μm de gruix
utilitzant el Criostat Leica CM1900. Les seccions es van fixar per immersions de 5 minuts en
acetona, acetona/cloroform (1:1) i novament acetona a -20ºC i es van deixar assecar durant
tota la nit a temperatura ambient. A continuació, es van rentar amb PBS i es van tractar
durant 10 minuts a les fosques amb 0.3% H2O2 en PBS. Després de rentar 3 cops amb PBS
durant 5 minuts, es van bloquejar durant 20 minuts a temperatura ambient amb 5% de
sèrum de conill (Vector) en PBS-BSA (PBS amb 2% BSA) i durant 10 minuts amb avidinbiotin blocking solution (Dako). Les seccions es van incubar amb l’anticòs de rata anti-CD31
murí (BD PharMingen) diluït 1/200 en tampó de bloqueig, durant tota la nit a 4ºC, dins una
cambra humida. Posteriorment, es van rentar i incubar amb l’anticòs secundari biotinilat antiRata (Vector) diluït 1/500, durant 30 minuts a temperatura ambient. Després de rentar, es
van incubar amb el reactiu ABC (Pierce) (preparat 30 minuts abans de ser utilitzat) durant 20
minuts a temperatura ambient. El senyal es va revelar incubant amb NovaRed (Vector). Per
acabar, es van deshidratar les mostres per immersió amb concentracions creixents d’etanol i
es va utilitzar medi de muntatge no aquós, DPX (Sigma), per cobrir les preparacions.
Per quantificar la vasculatura tumoral, de cada tall es van prendre 5 imatges de
diferents camps a 40 augments. Les imatges es van analitzar utilitzant el programa NIH
ImageJ (National Institutes of Health, Bethesda, Maryland, USA), delimitant en cada imatge
la zona corresponent al tumor i quantificant tant el no de vasos com l’àrea de cadascun
d’ells.
Per valorar la vasculatura de cada tumor es van tenir en compte dos paràmetres:
Densitat microvascular: M.V.D (v.p./mm 3)
M.V.D. =
106 u (Suma del número de vasos als 5 camps)
Àrea del tumor analitzada als 5 camps (μm2 )
Fracció d’àrea dels vasos: A.A. (%)
A.A. =
Suma de l'àrea dels vasos als 5 camps (μm2 )
Àrea del tumor analitzada als 5 camps (μm2 )
79
3.6.5.2.
Tinció d’hematoxilina/eosina
Talls de 5 μm de gruix dels tumors inclosos en parafina es van tenyir amb
hematoxilina/eosina segons el protocol descrit a continuació: després de 30 minuts a 37ºC,
es va desparafinar el teixit mitjançant 2 rentats de 2 minuts amb xilol. A continuació, es van
hidratar els talls mitjançant 2 immersions de 2 minuts en etanol 100%, i 2 immersions de 1
minut en etanol 96%. Després de rentar en ddH2O durant 2 minuts més, es van submergir
els talls en solució d’hematoxilina durant 5 minuts. A continuació, els talls es van rentar amb
aigua corrent indirecta durant 2 minuts, es van submergir en alcohol àcid (etanol 70% amb
HCl 120 mM) durant 30 segons, es van tornar a rentar 3 minuts amb aigua corrent i es van
submergir durant 10-60 segons en aigua amoniacal (NaHCO3 240 mM i MgSO4 1,7 m M) de
manera que les estructures tenyides van agafar un to blavós. Després de comprovar al
microscopi que la tinció era correcta, es va realitzar un rentat de 3 minuts amb aigua corrent.
A continuació, es van fer 2 rentats de 2 minuts amb etanol 96% i es van tenyir els talls amb
eosina durant 2 minuts. Per últim, es van realitzar 2 rentats de 2 minuts amb etanol 96%, 2
rentats de 2 minuts amb etanol 100% i 2 rentats de 2 minuts amb xilol, abans de cobrir les
preparacions amb el medi de muntatge no aquòs DPX.
3.6.5.3.
Anàlisi de la necrosi intratumoral
Es van captar imatges de l’àrea completa dels talls dels tumors tenyits amb
hematoxilina/eosina a 40 augments amb el microscopi Leica AF-7000.
Per a la quantificació del percentatge d’àrea necròtica es va utilitzar el programa
d’anàlisi d’imatge NIH ImageJ (National Institutes of Health, Bethesda, Maryland, USA),
delimitant el contorn de tot el tumor (àrea total) i quantificant l’àrea de la zona necròtica dins
el teixit (àrea necròtica), tal com es mostra a la Figura 2.
T
T
N
N
Figura 2. Quantificació de la necrosi s intratumoral.
A l'esquerra, tinció amb hematoxilina/eosina del teixit tumoral. A la dreta, identificació de
l’àrea necròtica (N) i del teixit viu (T) dins el tumor.
80
Materials i Mètodes
De manera que:
Percentatge de necrosis intratumoral: N.T (%)
Necrosi Tumoral =
3.6.5.4.
Àrea necròtica dins el tumor (N)
Àrea total del tumor (N+T)
u 100
Anàlisi de marcadors específics
Tinció de S100A7:
Per a l’anàlisi de la presència de S100A7 en el teixit tumoral, es va realitzar la tinció de
talls de 5 μm de gruix de tumor inclosos en parafina. En concret, després de deixar els talls
un mínim de 30 minuts a 37ºC, es van desparafinar i hidratar les mostres mitjançant rentats
de 15 minuts en xilol, 5 minuts en etanol 100%, 5 minuts en etanol 96%, 5 minuts en etanol
70% i 5 minuts en PBS. A continuació es va realitzar el desemmascarament de l’antigen
submergint les mostres en tampó de citrat sòdic (citrat sòdic 0.1 M i 0.05% Tween-20, pH 6)
i escalfant-les al microones durant 15 minuts en cicles successius ON/OFF per tal d’evitar
l’ebullició. Després de deixar refredar les mostres durant 20 minuts a temperatura ambient
en PBS, es va realitzar el bloqueig de peroxidasa amb una solució al 0.3% de H2O2 en PBS
durant 10 minuts i es van realitzar 2 rentats de 5 minuts amb PBS. Per evitar possibles
unions inespecífiques de l’anticòs secundari, es van bloquejar els talls amb PBS al 5% de
sèrum de cabra (Sigma). La incubació de l’anticòs primari anti-S100A7 es va realitzar a una
concentració de 2 μg/ml en solució de bloqueig, durant tota la nit a 4ºC, en una cambra
humida. A continuació, es van rentar els talls 3 cops amb PBS i es va incubar l’anticòs
secundari de cabra anti-IgG de ratolí biotinilat (Vector) a 2 μg/ml en solució de bloqueig,
durant 1 hora a temperatura ambient, dins una cambra humida. Després de rentar, es van
incubar amb el reactiu ABC (Pierce) (preparat 30 minuts abans de ser utilitzat) durant 20
minuts a temperatura ambient. El senyal es va revelar incubant amb NovaRed (Vector).
Quan el senyal obtingut va ser prou intens, es va aturar la reacció per immersió dels talls en
PBS. Per últim, es va realitzar una lleugera tinció amb hematoxilina durant 3 minuts i es van
muntar les mostres amb medi DPX tal com s’ha descrit a l’apartat 3.6.5.2., sense realitzar la
tinció amb eosina.
En els casos on es va utilitzar l’anticòs anti-S100A7 2D9-biotinilat com anticòs primari,
el bloqueig es va realitzar amb la solució avidin-biotin blocking solution (Dako) seguint les
instruccions del fabricant. Després d’incubar l’anticòs primari a 2 μg/ml en PBS al 1% de
BSA (durant tota la nit a 4ºC), es van rentar les mostres i es van incubar amb estreptavidina-
81
HRP (Dako) diluïda 1/300 en PBS durant 1 hora a temperatura ambient. El revelat del senyal
es va realitzar tal com s’ha descrit anteriorment.
Presència de l’anticòs dins el tumor:
Talls de 5 μm dels tumors es van desparafinar i hidratar seguint el protocol descrit a
l’apartat anterior. En aquest cas, el bloqueig es va fer amb la solució avidin-biotin blocking
solution (Dako) durant 10 minuts i els talls es van incubar amb estreptavidina-HRP (Dako)
diluïda 1/300 en PBS durant tota la nit a 4ºC en cambra humida.
Tinció de α-SMA:
Talls de 5 μm de tumors en parafina es van desparafinar i hidratar seguint el protocol
descrit. A continuació, els talls es van bloquejar amb PBS al 2% BSA durant 1 hora en
cambra humida i es va incubar l’anticòs primari anti-α-Smoth Muscle Actin (α-SMA) de ratolí
conjugat amb FITC (isotiocianat de fluoresceïna) (Sigma) a una dilució de 1/200 en tampó
de bloqueig, durant tota la nit a 4ºC en cambra humida. Al dia següent es van fer 3 rentats
de 5 minuts amb PBS i es van tenyir els nuclis amb Bisbenzimide Hoechst 33342 (Sigma) a
una dilució 1/1000 en PBS (10 minuts a temperatura ambient, en cambra humida). Després
d’un últim rentat amb PBS, es va utilitzar Mowiol® (Sigma) com a medi de muntatge. Els
resultats es van analitzar al microscopi invertit Leica DM-IRBE i es van prendre imatges a
200 augments utilitzant el programa MetaMorph®.
3.6.5.5.
Anàlisi de la fibrosi hepàtica
L’anàlisi del col·lagen dins el fetge es va realitzar tal com s’ha descrit anteriorment
(Coleman, 2011; Junqueira et al., 1979). En concret, es van realitzar seccions de 5 μm de
gruix dels fetges inclosos en parafina i es van desparafinar i hidratar tal com s’ha detallat.
Després de rentar les mostres amb ddH2O, es va realitzar una tinció amb Picrosirius (1% de
Sirius Red F3B (Sigma) en una solució aquosa saturada d’àcid pícric (1.2%)) durant 1 hora a
temperatura ambient. A continuació, es van realitzar dos rentats de 5 minuts amb aigua
acidificada (aigua al 0.5% d’acètic glacial), es van deshidratar els talls amb concentracions
creixents d’etanol i es va fer el muntatge amb medi DPX tal com s’ha descrit anteriorment.
82
Materials i Mètodes
3.7. Seqüenciació dels anticossos monoclonals anti-S100A7
3.7.1. Extracció del RNA i obtenció del cDNA
De cadascun dels sis hibridomes seleccionats en els assaigs in vitro, es va obtenir un
pellet de 2 milions de cèl·lules. Mantenint el tub en gel, es va afegir sobre el pellet sec 1 ml
de Trizol® Reagent (Life Technologies), es va agitar al vòrtex durant 1 minut i es va deixar
en gel durant 5 minuts. A continuació, es van afegir 200 μl de cloroform a 4ºC, es va tornar a
agitar al vòrtex i es va deixar reposar 5 minuts més en gel. Es va centrifugar a 12.000 rpm
durant 10 minuts i 4ºC i es va recollir la fase superior de la barreja. A continuació, es van
afegir 600 μl d’isopropanol i es va deixar reposar durant 15 minuts en gel. Es va tornar a
centrifugar i es va descartar el sobrenedant. Sobre el pellet sec de RNA, es va afegir 1 ml
d’etanol 70% i es va tornar a centrifugar. Aquest pas es va repetir 2 cops. Per últim, es va
descartar el sobrenedant i es va deixar assecar el tub completament abans de resuspendre
el pellet de RNA en 50 μl de ddH2O. La concentració de RNA es va quantificar amb un
NanoDrop® 2000c (Thermo) a una longitud d’ona de 260 nm.
Un microgram de RNA es va fer servir per obtenir el cDNA de cadena senzilla utilitzant
el kit GoScriptTM Reverse Transcription System (Promega) i seguint les instruccions del
fabricant.
3.7.2. Seqüenciació
Per amplificar les seqüències de la regió variable tant de la cadena pesada (VH ) com
de la cadena lleugera (VL) es va utilitzar una barreja d’encebadors degenerats que
s’uneixen, per l’extrem 5’, al pèptid senyal o al framework 1 (FR1) i, per l’extrem 3’, al
framework 4 (FR4) o a la regió constant (Figura 3) de la seqüència de l’anticòs.
Pèptid senyal
Regió constant
Regió variable
FR1
FR2
FR3
FR4
3’
5’
5’
3’
Encebadors:
VL (13)
VH (15)
VL (9)
VH (7)
VL (2)
VH (4)
V L (1)
V H (1)
Figura 3. Encebadors utilitzats per a l’amplificació de la regió variable.
Entre parèntesis es mostra el nombre d’encebadors utilitzats per amplificar la seqüència
de la cadena lleugera (V L) o de la c adena pesada (V H ) de cada anticòs monoclonal. Dins
de la regió variable de l’anticòs, els CDRs 1, 2 i 3 es troben flanquejats pels f ramework s
(FR1, 2, 3 i 4).
83
L’amplificació de les bandes es va dur a terme per PCR a partir de 150 ng de cDNA en
un volum de reacció de 20 μl amb 2 U de Taq polimerasa (KAPA Biosystems), 10% de
tampó de PCR (KAPA Biosystems), 0.2 mM de dNTPs (Fermentas) i 0.2 μM de cada
encebador. Les reaccions es van fer al termociclador Arktik TM Thermal Cycler (Thermo) amb
el següent protocol: desnaturalització inicial a 94ºC durant 5 minuts, seguida de 30 cicles de
30 segons a 94ºC, 1 minut a 55ºC i 2 minuts a 72ºC, i amplificació final durant 2 minuts a
72ºC. Per a cada cadena es van realitzar 4 reaccions en paral·lel en funció de la barreja
d’encebadors utilitzada: pèptid senyal+FR4, pèptid senyal+regió constant, FR1+FR4 o
FR1+regió constant (Taula 3).
Taula 3. Encebadors utilitzats per a la seqüenciació dels anticossos monoclonal s.
Cadena Pesada (VH)
Seqüència (5’ Æ 3’)
Encebador
Pèptid senyal (PS)
MHR-1
MHR-2
MHR-3
MHR-4
MHR-5
MHR-6
MHR-7
MHR-8
MHR-9
MHR-10
MHR-11
MHR-12
MVR-H-L1
MVR-H-L2
MVR-H-L3
LPxPS_VH
Framework 1 (FR1)
W-MH1
W-MH2
W-MH3
W-MH4
W-MH5
W-MH6
W-MH7
Framework 4 (FR4)
MVR-H-J1
MVR-H-J2
MVR-H-J3
MVR-H-J4
Regió constant (cte)
mIgG1-rev
84
Materials i Mètodes
Cadena Lleugera (VL)
Seqüència (5’ Æ 3’)
Encebador
Pèptid senyal (PS)
MLR-2
MLR-3
MLR-4
MLR-5
MLR-6
MLR-7
MLR-8
MLR-9
MLR-10
MLR-11
MVR-L-L2
MVR-L-L3
MVR-L-L4
MVR-L-L5
LPxPS_VL1
LPxPS_VL2
Framework 1 (FR1)
VK1BACK
VK2BACK
VK3BACK
VK4BACK
VK5BACK
VK6BACK
VK7BACK
VK8BACK
VK9BACK
Framework 4 (FR4)
MVR-L-J1-4
MVR-L-J5
Regió constant (cte)
mIgK-rev
Cadena Lleugera Aberrant (VL Abr)
Abr1 forward
Abr3 reverse
Símbols: R=A+G; Y=C+T; m=A+C; K=G+T; S=G+ C; W=A+T; H=A+T+ C; B=G+T+ C;
D=G+A+T; N=A+ C+G+ T; V=G+A+C.
El producte de PCR es va resoldre en un gel d’electroforesis al 2% d’agarosa
copolimeritzat amb GelStarTM Nucleic Acid Gel Stain (Lonza) a una dilució de 1/20.000,
afegint sobre els 20 μl de reacció 4 μl de tampó de càrrega 6X DNA Loading (Thermo). La
visualització de les bandes es va fer sota llum ultravioleta i el pes molecular es va estimar
per comparació amb el marcador de pes molecular GeneRuler 1 kb (Thermo). Les bandes
85
d’interès es van retallar del gel i es van purificar utilitzant el kit NucleoSpin® Nucleic Acid
Purification (MACHEREY-NAGEL).
La banda purificada (15 ng) es va lligar en el vector linealitzat pJET1.2/blunt (50 ng) de
CloneJET PCR Cloning kit (Thermo) seguint les instruccions del fabricant, en un volum total
de 20 μl. A continuació, el producte lligat es va transformar en cèl·lules competents de la
soca E. coli JM109, segons el següent protocol: 50 μl de cultiu bacterià es van afegir sobre 5
μl del producte de lligació i es va deixar en gel durant 30 minuts, agitant suaument cada 10
minuts. A continuació, es va submergir el tub en un bany a 42ºC durant 30 segons i
seguidament en gel durant 30 segons més. Es van afegir 200 μl de medi SOC (Sigma)
prèviament temperat a 37ºC i es va portar el tub a l’incubador, on es va deixar 1 hora a 37ºC
i 250 rpm. Per últim, es va plaquejar l’inòcul bacterià sobre plaques de petri amb LB +
ampicil·lina (100 μg/ml, Sigma) i es va deixar a l’incubador a 37ºC durant tota la nit. Al dia
següent, es va observar el creixement de les colònies bacterianes. Degut al vector utilitzat,
totes les colònies presents a la placa han de contenir la banda inserida, ja que la
recircularització del vector permet l’expressió d’un gen mortal pel bacteri. Per confirmar la
presència de la banda inserida es van picar 20 colònies per a cada cadena i es van utilitzar
els encebadors proporcionats pel kit de CloneJET per analitzar per PCR la presència i mida
del fragment amplificat. A més, es va fer una segona anàlisi per PCR on es van utilitzar els
encebadors específics amb els quals es va amplificar la banda a partir del cDNA. El
producte de PCR es va resoldre tal com s’ha indicat anteriorment.
Es van seleccionar 10 de les colònies analitzades, en les que s’havia confirmat la
presència de la banda inserida, i es van fer créixer en 5 ml de medi LB amb ampicil·lina
durant tota la nit a 37ºC i 250 rpm. A continuació, 4 ml de l’inòcul es van utilitzar per realitzar
la purificació del plasmidi utilitzant GenEluteTM Plasmid Miniprep kit (Sigma). A més, es va
guardar un stock de glicerol de cada colònia, barrejant 700 μl de l’inòcul amb 300 μl de
glicerol estèril al 30% en H2O i congelant la barreja a -80ºC per a posteriors usos.
La seqüenciació de cada cadena a partir dels plasmidis purificats es va fer a Macrogen
Inc. (Amsterdam, Holanda).
Per a l’anàlisi de les seqüències es va utilitzar el programa CLC Sequence Viewer
(Qiagen). Les seqüències dels 10 clons es van alinear per obtenir la seqüència consens
corresponent a la regió variable de cada cadena. La regió corresponent als encebadors es
va excloure de l’anàlisi per evitar resultats erronis degut a la degeneració de la seva
seqüència.
86
Materials i Mètodes
3.8. Anàlisi estadístic
En tots els estudis, els valors s’expressen com la mitjana ± l’error estàndard de la
mitjana (SEM). Per a la comparació de les mitjanes obtingudes es va utilitzar el test no
paramètric de la U de Mann Whitney, utilitzant el programa GraphPad Prism, versió 5.04 per
Windows. Les diferències es van considerar significatives quan p<0.05.
Tots els assaigs es van repetir un mínim de 3 vegades independents, fent servir de 2 a
6 rèpliques de cada condició per assaig.
87
Materials i Mètodes
89
Resultats
4. RESULTATS
4.1. Obtenció de la proteïna recombinant S100A7
Per estudiar la funció de la proteïna S100A7 in vitro i per obtenir anticossos
monoclonals contra ella, va ser necessari clonar la proteïna i produir-la al laboratori.
La seqüència completa codificant de la proteïna S100A7 es va amplificar per PCR a
partir del cDNA de la línia tumoral humana MDA-MB-468 amb uns encebadors específics i
es va clonar en el vector de transició pGEM-T Easy. Un cop comprovada la identitat de la
seqüència i que no tenia mutacions, es va clonar en el vector d’expressió per a procariotes
pET28a, i es van transformar bacteris E. coli TunerTM per a la seva producció. La seqüència
de la proteïna obtinguda va incloure una cua d’histidines (His-Tag) a l’extrem N-terminal per
facilitar la purificació, a més d’un lloc de restricció per a la trombina que permetia eliminar la
cua en cas que fos necessari (Figura 1).
His-Tag
Trombina
MGSSHHHHHHSSGLVPRGSHMSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENF
PNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Figura 1. Seqüència de la proteïna recombinant humana S100A7.
En negre, la seqüència de la proteïna humana S100A 7. En vermell, els tres aminoàcids
addicionals presents a la seqüència després de digerir amb t rombina. En verd, la resta
de la cua que conté les sis histidines.
Les condicions i el temps d’inducció de l’expressió de la S100A7 es van optimitzar de
manera que la producció fos màxima. Es va determinar que la inducció amb 1 m M d’IPTG
durant 6 hores era el temps òptim per obtenir la major quantitat de proteïna en la fracció
soluble.
Per comprovar l’eficiència de la producció de la proteïna, es va realitzar una
electroforesis SDS-PAGE del cultiu bacterià lisat amb tampó RIPA. A la Figura 2A s’observa
clarament la banda corresponent a la proteïna recombinant S100A7 entre altres proteïnes
bacterianes.
91
A
B
1
2
3
4
5
6
7
8 9 10
C
SDS-PAGE
28 kDa
S100A7rh
(13.9 kDa)
13.9 kDa
S100A7rh
Lisozima
WB
Dímer
Monòmer
Figura 2. Anàlisi per SDS-P AGE de la producció i la purificació de la proteïna
recombinant humana S100A7.
A) Anàlisi de l’extracte de proteïna total del bacteri (5 μg) a les 6 hores d’induir
l’expressió de S100A7. B) Anàlisi de les fraccions obtingudes durant la purificació de la
proteïna. 1- Extracte bacterià després de ser lisat i abans de passar per columna. 2Extracte bacterià després de passar per columna. 3- Rentat amb tampó fos fat a 20 mM
d’imidazol. 4- Rentat amb tampó fos fat a 50 mM d’imidazol. 5 i 6- Rentats amb tampó
fos fat a 100 mM d’imidazol. 7, 8 i 9- Rentats amb tampó fos fat a 300 mM d’imidazol. 10Rent at amb tampó fosfat a 500 mM d’imidazol. C) Anàlisi per SDS-PA GE de la proteïna
purificada (15 μg) i det ecció per western blot (50 ng) amb un anticòs comercial
(Imgenex).
Per purificar la proteïna a partir de l’extracte bacterià, es van utilitzar columnes de
níquel que retenien la proteïna S100A7 per la cua d’histidines. L’elució es va realitzar rentant
amb concentracions creixents d’imidazol. La Figura 2B mostra l’anàlisi de les fraccions
obtingudes durant el procés de purificació. Com es pot observar, després de passar
l’extracte bacterià per la columna, la proteïna S100A7 queda retinguda i només s’observa al
gel la banda corresponent a la lisozima (carril 2). Aquesta mateixa banda corresponent a
restes de lisozima es veu en el rentat de columna amb tampó fosfat a 20 mM d’imidazol
(carril 3), a més d’altres proteïnes bacterianes de major pes molecular. En els rentats amb
tampó fosfat a 50 i 100 m M d’imidazol es van eliminar altres proteïnes bacterianes unides de
manera lleu a la columna (carrils 4 a 6). Quan es va rentar amb tampó fosfat a 300 mM
d’imidazol, la proteïna S100A7 va eluir amb una elevada puresa (carrils 7 a 9) i amb el rentat
amb tampó fosfat a 500 m M d’imidazol ens vam assegurar que no quedava proteïna
retinguda a la columna (carril 10). Les fraccions que contenien la proteïna es van concentrar,
tamponar amb PBS i quantificar per a la seva conservació en alíquotes estèrils. La Figura
2C mostra la puresa de la proteïna obtinguda (>97%). L’anàlisi per western blot de la mostra
purificada amb un anticòs comercial va confirmar la identitat de la S100A7 recombinant
humana.
92
Resultats
Degut a la procedència bacteriana de la proteïna, era d’elevada probabilitat que durant
el procés de purificació s’haguessin arrossegat petites quantitats d’endotoxines. L’agent
actiu principal d’aquestes endotoxines és el lipopolisacàrid (LPS), un component essencial
de la membrana de bacteris Gram-negatives. El LPS interacciona amb receptors de
membrana, induint una resposta sobre diferents tipus cel·lulars, com les endotelials o els
macròfags (Andreakos et al., 2004). A la Taula 1 es mostra el resultat de la quantificació i
l’equivalència entre la concentració de S100A7 i la concentració d’endotoxines.
Taula 1. Concentració d’endotoxines pre sent a la S100A7 recombinant humana
S100A7
Endotoxines
0.3 μM
1.35 ng/ml
1 μM
4.5 ng/ml
3 μM
13.5 ng/ml
Tenint en compte aquest resultat, en alguns experiments va ser necessari comprovar
que l’efecte induït per la proteïna recombinant era degut a la S100A7 i no a les endotoxines
presents. Amb aquest propòsit, es va realitzar un control amb LPS a la concentració
corresponent, en funció de la quantitat de S100A7 utilitzada.
4.2. Obtenció d’anticossos monoclonals específics contra la
proteïna S100A7
En el moment en què es va iniciar el projecte, el coneixement sobre el paper
extracel·lular de la proteïna S100A7 era pràcticament nul i no hi havia cap dada a la
bibliografia sobre l’ús d’anticossos monoclonals anti-S100A7 com a possible estratègia
terapèutica per a malalties associades a una sobreexpressió de la proteïna (càncer,
psoriasis, malalties inflamatòries, etc.). A més, els anticossos disponibles en el mercat per a
ús en diferents tècniques de biologia molecular eren escassos. Per tot això i per l’interès
estratègic del centre, un cop obtinguda la proteïna recombinant, es van voler obtenir
anticossos monoclonals específics per tal d'utilitzar-los com a eina de diagnòstic i també
com agent terapèutic, un cop confirmada la importància de la proteïna S100A7 en el
desenvolupament tumoral.
En concret, es van obtenir 16 línies d’hibridoma productores d’anticossos monoclonals.
Cadascuna d’elles es va expandir per tal de produir i purificar anticòs suficient per fer la
selecció in vitro dels més eficaços bloquejant la funció extracel·lular de la proteïna. A la
93
Figura 3 es mostra un exemple de les fraccions obtingudes durant el procés de purificació de
cadascun dels anticossos.
A
1
2
3
4
5
6
H
7
B
H
(50 kDa)
L
L
(25 kDa)
Figura 3. Anàlisi de la purificació dels anticossos monoclonals anti-S100A7.
A) Anàlisi per SDS-PA GE de les fraccions obtingudes durant la purificació d’un dels
anticossos anti-S 100A 7 on s’obs erva la cadena pesada (H) i la cadena lleugera (L). 1Sobrenedant de l’hibridoma abans de la purificació. 2- S obrenedant de l’hibridoma
després de passar per columna. 3- Rentat de la columna. 4 a 7- Anticòs eluït. B)
Electroforesi SDS-PAGE de l’anticòs purificat (20 μg).
Com es pot veure a la Figura 3A, el sobrenedant lliure de sèrum conté proteïnes
procedents de cèl·lula morta a més de l’anticòs secretat per l’hibridoma (carril 1). Un cop
passat per la columna, tot l’anticòs del sobrenedant queda retingut a la resina (carril 2) i és
eluït posteriorment (carrils 4 a 7). La Figura 3B mostra la puresa de l’anticòs obtingut
(>97%). Finalment, es va quantificar i tamponar amb PBS estèril per al seu posterior ús.
4.3. Caracterització dels anticossos monoclonals anti-S100A7 i
utilitat com a eines de recerca
Al llarg del projecte va ser necessari analitzar la presència de S100A7 tant a nivell
cel·lular com en teixit, així com en diferents fluids (medi de cultiu i sèrum). Per això, era
important determinar si els anticossos obtinguts eren útils per ser utilitzats com a eina bàsica
de recerca.
Com es veurà més endavant, com a resultat dels assaigs in vitro es van seleccionar 6
dels 16 anticossos monoclonals com els més eficaços en bloquejar la funció extracel·lular de
la proteïna S100A7 (2D9, 2H3, 6E3, 6F5, 8B6 i 9F3). L'ús d'aquests sis anticossos, tant per
a teràpia com per a diagnòstic, es va protegir dins d’una aplicació de patent
(WO/2014/167030). Per tant, l’estudi de la utilitat dels anticossos en diferents tècniques de
94
Resultats
biologia molecular es va limitar als sis anticossos seleccionats. D’altra banda, es va realitzar
una breu caracterització dels 16 anticossos monoclonals obtinguts, tal com s’explica a
continuació.
En primer lloc, es va determinar l’isotip dels 16 anticossos, la gran majoria dels quals
va ser IgG1/kappa, a excepció del 6E9 (IgG2a/kappa), el 11D9 (IgG2b/kappa) i el 8B6
(IgG1/lambda).
En segon lloc, es va estudiar, mitjançant la tècnica d’ELISA, l’especificitat dels
anticossos front d’altres membres de la fam ília de les S100. Com a resultat, es va veure que
els anticossos no reconeixien cap de les proteïnes de la família estudiades (S100A2,
S100A4, S100A6, S100A14, S100B i S100P), a banda de la S100A7. Aquest resultat es pot
explicar pel percentatge d’identitat de la seva seqüència front la resta de proteïnes
estudiades, sempre per sota d’un 30% d’homologia (Figura 4). No obstant, seria necessari
realitzar estudis més amplis, incloent la resta de membres de la família, ja que, per exemple,
la proteïna S100A15 (també anomenada S100A7a) només es diferencia de la S100A7 en 7
aminoàcids (93% d’identitat), per la qual cosa és possible que alguns dels anticossos siguin
capaços de reconèixer ambdues proteïnes.
S100A7
S100A2
!
S100A4
S100A6
S100A14
S100B
S100P
S100A7
S100A2
S100A4
S100A6
S100A14
S100B
S100P
!! 25% d’identitat
! 25% d’identitat
! 26% d’identitat
! 30% d’identitat
25% d’identitat
26% d’identitat
30% d’identitat
Figura 4. Alineament de les seqüències proteiques de les S100 e studiades.
Utilitzant el programa Protein BLAS T® (NCBI) es va alinear la seqüència de la proteïna
S100A7 humana envers les proteïnes S100 indicades i es va calcular el percentatge
d’identitat.
A més, un punt important en l’estudi dels anticossos obtinguts era determinar la seva
reactivitat amb la forma murina de la proteïna S100A7. Per poder-ho fer, es va obtenir la
S100A7 murina recombinant de la mateixa manera que la proteïna humana. Com es pot
95
veure a la Figura 5A, només els anticossos 11D9 i 2G8 van mostrar una reactivitat clara
envers la forma murina de la proteïna, tot i que el reconeixement va ser molt inferior a
l’observa’t per a la S100A7 humana. L’anticòs comercial anti-S100A7 murina (Onlineantibodies) es va utilitzar com a control positiu. El 6F5 va mostrar una lleugera reactivitat per
la S100A7 murina, igual que el 1E1 i el 6E9 (no mostrats), mentre que la resta d’anticossos,
com el 2D9 o el 9F3 (mostrats a la Figura 5) no van detectar la proteïna murina. Aquest fet
no és sorprenent si tenim en compte la gran diferència que existeix entre les dues
seqüències (Figura 5B).
A
1
2
1
2
1
2
1
2
1
2
1
2
S100A7r
(14 kDa)
Comercial
mAb 2D9
mAb 9F3
mAb 6F5
mAb 2G8
mAb 11B9
B
Humana
Murina
!!
!
Humana
Murina
!
! 32% d’identitat
Figura 5. Reactivitat dels anticossos envers la S100A7 humana i la murina.
A) Anàlisi per Western blot de 5 μg de S100A7 murina (carril 1) i 5 ng de S100A7
humana (carril 2) utilitzant els anticossos anti-S100A7 a 2 μg/ml. B) Anàlisi d’homologia
entre la proteïna S100A7 humana i la murina utilitzant el programa Protein BLAST®
(NCBI).
Mentre que altres membres de la família de les S100 guarden una elevada similitud
amb els seus ortòlegs d'altres espècies (per exemple, la S100A4 guarda un 93%
d’homologia entre la forma humana i la murina), la proteïna S100A7 té molt poca identitat
amb la forma murina. De fet, es va identificar aquesta proteïna com la S100A7 murina per
motius estructurals i funcionals, com son la seva localització cromosòmica, la conservació de
dominis d’unió a Jab1 i el patró d’expressió en diferents teixits, més que per una similitud a
nivell de seqüència (Webb et al., 2005).
96
Resultats
4.3.1. Utilitat dels anticossos per western blot
Com a punt de partida del projecte, es va voler caracteritzar l’expressió de la S100A7
al material biològic de que disposàvem al laboratori (cèl·lules i teixits). Per això, era
necessari seleccionar un bon anticòs que reconegués la proteïna de manera específica per
la tècnica de western blot.
Es va realitzar l’anàlisi amb extracte total de la línia tumoral MDA-MB-468 (amb alts
nivells d’expressió de S100A7 (Petersson et al., 2007)) i la proteïna recombinant humana
com a control positiu. A la Figura 6 es mostra el resultat obtingut per a l’anticòs comercial
d’Imgenex i dos dels nostres anticossos (5F11 i 9F3).
Comercial
A
B
mAb 5F11
A
B
mAb 9F3
A
28 kDa
B
Dímer
13.9 kDa
11.4 kDa
Monòmer
Figura 6. Ús del s anticossos anti-S100A7 per western blot.
Els anticossos anti-S100A7 es van utilitzar a 2 μg/ml sobre 100 μg d’extracte total de la
línia t umoral humana MDA-MB -468 (A ) i 50 ng de proteïna recombinant humana S100A7
(B).
Tots els anticossos obtinguts contra la S100A7 van funcionar de manera similar, tot i
que el comercial i alguns dels propis (com el 5F11) van donar bandes inespecífiques a la
concentració utilitzada. L’anticòs 9F3 va ser el que va donar els millors resultats i per tant el
vam seleccionar per a utilitzar-lo en els posteriors anàlisis de western blot.
4.3.2. Ús dels anticossos per immunohistoquímica
A banda de la funcionalitat dels anticossos monoclonals per western blot, es va voler
determinar la seva utilitat com a eina de diagnòstic en teixit parafinat i així poder estudiar la
distribució de la proteïna S100A7 a nivell tissular.
Es van realitzar tincions de talls parafinats de tumors de la línia A431 amb els
anticossos 2D9, 2H3, 6E3, 6F5, 8B6 i 9F3. A la Figura 7 es veu el resultat de la tinció de la
mateixa zona del teixit obtinguda amb cadascun dels anticossos estudiats.
97
2D9
2H3
6E3
C-
6F5
8B6
9F3
Figura 7. Tinció per immunohi stoquímica de la S100A7 amb els anticossos
obtinguts.
Talls consecutius de 5 μm de gruix d’un tumor de la línia cel·lular A431 inclòs en parafina
es van tenyir utilitzant els anticossos anti-S100A7 a 2 μg/ml. Imatges preses a 200
augments de la mateixa zona del teixit. El control negatiu (C-) mostra el marcatge en
absència d’anticòs primari.
Com es pot observar, tots els anticossos van servir per detectar la S100A7 per
immunohistoquímica en teixit parafinat, excepte el 2H3.
El protocol utilitzat en aquesta tinció implica la utilització d’un anticòs secundari antiratolí per detectar l’anticòs anti-S100A7. Això pot donar un cert soroll de fons, sobretot en els
casos en què el ratolí ha estat tractat prèviament amb anticossos murins contra la proteïna
S100A7. Per evitar-ho, un cop comprovat que 5 dels 6 anticossos eren útils per a aquesta
tècnica, es va posar a punt un protocol on es va utilitzar l’anticòs 2D9-biotinilat com anticòs
primari i l’estreptavidina-HRP enlloc del secundari anti-ratolí. D’aquesta manera, el soroll de
fons es va reduir considerablement, mantenint-se l’especificitat de la tinció per a la proteïna
S100A7.
4.3.3. Utilitat dels anticossos per immunocitoquímica
Per determinar la localització de la S100A7 dins de la cèl·lula i veure si la seva
expressió és homogènia dins el cultiu, es va utilitzar la tècnica d’immunocitoquímica. Vam
voler veure si l’anticòs 9F3 servia per detectar la proteïna en aquest tipus d’assaig.
98
Resultats
Es va realitzar la tinció en la línia MDA-MB-468. Com es mostra a la Figura 8, l’anticòs
9F3 permetia detectar la S100A7 amb una bona sensibilitat, i per tant es va escollir per
utilitzar-lo en els estudis d’immunocitoquímica posteriors.
Nuclis
S100A7
Superposició
Figura 8. Tinció per immunocitoquímica de la proteïna S100A7 amb l'anticòs 9F3.
Cèl·lules de la línia tumoral MDA-MB -468 es van tenyir utilitzant l’anticòs anti-S100A7
9F3 a 2 μg/ml. A dalt a l’esquerra, tinció dels nuclis de les cèl·lules amb Hoescht (blau).
A dalt a la dret a, tinció de la S100A7 amb el 9F3 (verd). A baix, imatge superposada de
les dues tincions.
4.3.4. Determinació de la sensibilitat dels anticossos monoclonals
Un altre paràmetre rellevant a l’hora de caracteritzar un anticòs és la seva sensibilitat.
Per determinar la sensibilitat dels anticossos obtinguts, es va realitzar un ELISA i es va
calcular el límit de detecció, tal com es detalla a l’apartat de materials i mètodes. A la Taula
2 es mostra la concentració mínima de S100A7 que els anticossos analitzats van ser
capaços de detectar.
Els anticossos 9F3 i 8B6 van ser els més sensibles, mentre que el 6F5 va presentar el
límit de detecció més elevat.
99
Taula 2. Límit de detecció dels anticossos anti-S100A7.
Anticòs
Límit de detecció
2D9
2,00 ng/ml
2H3
2,00 ng/ml
6E3
2,00 ng/ml
6F5
5,12 ng/ml
8B6
0,82 ng/ml
9F3
0,82 ng/ml
4.3.5. Obtenció d'un kit de diagnòstic per S100A7 basat en la tècnica del
sandwich ELISA
Les proteïnes S100 tenen la capacitat de ser secretades a l’espai extracel·lular, tot i
que el mecanisme exacte pel qual ho fan roman encara per determinar. Aquest fet fa que
siguin bons candidats com a possibles biomarcadors per diferents malalties relacionades
amb la seva sobreexpressió (Chen et al., 2014a). Per exemple, estudis previs han suggerit
que la proteïna S100A7 pot ser un bon biomarcador de diagnòstic per malalties com el
càncer o l’Alzheimer (Qin et al., 2009; Zhang et al., 2008).
Amb l’objectiu de determinar la presència de la S100A7 en diferents fluids (tant al
sobrenedant de cultius cel·lulars com en fluids biològics com ara la sang), vam voler
desenvolupar al laboratori un sistema de sandwich ELISA amb els nostres anticossos que
servís per quantificar la proteïna.
Per a l’obtenció del sandwich ELISA, primer va ser necessari seleccionar la millor
parella d'anticossos, és a dir, aquells que reconeguessin la proteïna amb una bona
sensibilitat i que tinguessin epítops prou distants en l'estructura tridimensional de la proteïna
per tal d’evitar impediments estèrics.
Es van biotinilar els 6 anticossos anti-S100A7 seleccionats (2D9, 2H3, 6E3, 6F5, 8B6,
9F3) per utilitzar-los com a anticossos de detecció a l'ELISA, amb un resultat d’entre 0.6 i 0.8
biotines per anticòs.
Es va fer un recobriment de la placa amb cadascun dels 6 anticossos s ense biotinilar
(anticòs de captura) i, després de bloquejar i incubar la proteïna S100A7 a una concentració
fixa, cadascun dels anticossos del recobriment es va enfrontar amb cadascun dels 6
anticossos primaris biotinilats (anticòs de detecció), formant les 36 parelles possibles. El
100
Resultats
resultat de cada parella es va valorar en funció del factor obtingut en dividir el senyal en
presència de S100A7 entre el senyal en absència de la proteïna.
Anticòs de detecció
Anticòs de captura
A
2D9
2H3
6E3
6F5
8B6
9F3
2D9
0,252
1,167
0,893
2,322
0,489
3,404
2H3
0,696
0,221
0,617
1,898
0,324
2,978
6E3
0,787
1,006
0,323
1,890
0,353
3,158
6F5
0,629
0,741
0,528
0,281
0,294
2,362
8B6
0,585
0,829
0,518
1,443
0,321
2,713
9F3
2,962
2,931
2,455
1,308
1,143
0,381
Anticòs de detecció
Anticòs de captura
B
2D9
2H3
6E3
6F5
8B6
9F3
2D9
4,32
8,64
6,61
10,72
3,28
7,16
2H3
7,07
4,10
4,31
10,31
5,61
6,75
6E3
9,90
13,14
4,30
13,79
4,55
10,37
6F5
5,54
5,67
4,17
4,22
3,54
9,35
8B6
5,51
9,69
5,75
13,05
3,65
7,78
9F3
17,37
13,83
14,23
10,59
8,47
4,53
Figura 9. Selecció de la millor parella d'anticossos pel sandwich ELISA.
Sis anticossos anti-S100A7 es van unir a la placa d'ELISA i es van enfrontar amb els
mateixos 6 anticossos biotinilats. A) V alor de OD (450 nm) obtinguda per a cada parella
en presència de 50 ng de S100A 7. B) Relació obtinguda en dividir la OD en presència de
S100A7 entre la OD en abs ència de S100A 7 (soroll de fons) per a cada parella.
Tot i que algunes parelles donen un valor de densitat òptica molt elevat en presència
de S100A7, també tenen un soroll de fons massa elevat, com és el cas de les parelles
formades amb el 9F3 com a anticòs de detecció (Figura 9A). Per això, en aquests casos la
relació entre el senyal en presència de S100A7 i el senyal en absència de la proteïna és
més baixa (Figura 9B). Tenint en compte aquests dos paràmetres, es va seleccionar la
parella formada pel 9F3 com a anticòs de captura i el 2D9 com a anticòs de detecció.
Donat que la incorporació de biotines obtinguda al laboratori per a l’anticòs 2D9 va ser
molt baixa (menys d’una biotina per anticòs), es va encarregar la biotinilació d’un lot de 50
mg a una empresa externa (GeneScript), obtenint una relació biotina/anticòs de 10.5.
D’aquesta manera, tots els estudis posteriors es van realitzar amb el mateix lot, reduint la
variabilitat entre assaigs. A més, el major nombre de biotines va permetre augmentar la
sensibilitat de l'ELISA considerablement.
101
A la Figura 10 s’observa un exemple de la recta patró amb S100A7 recombinant
humana utilitzada per quantificar la proteïna en diferents medis i fluids. Després d’extreure el
valor de densitat òptica obtingut a 0 ng/ml de proteïna (soroll de fons), la corba es satura a
partir de 25 ng/ml (Figura 10A). Per quantificar la S100A7 de les mostres, es va seleccionar
la zona lineal de la corba (marcada amb fons gris) i es va calcular la fórmula de la regressió
lineal, com es mostra a la Figura 10B, on y = concentració de S100A7 i x = densitat òptica
sense el soroll de fons. Després d’optimitzar el protocol del sandwich ELISA, es va
aconseguir detectar la proteïna S100A7 humana a concentracions de fins a 1.5 ng/ml.
A
B
4.0
Zona lineal
2.5
3.0
DO (450 nm)
DO (450 nm)
3.5
2.5
2.0
1.5
1.0
2.0
1.5
1.0
y = 0,1692x + 0,0704
0.5
R² = 0,9921
0.0
0.5
0.0
0.0
0
20
40
60
80
100
120
2.5
5.0
7.5 10.0 12.5 15.0
Concentració S100A7 (ng/ml)
Concentració S100A7 (ng/ml)
Figura 10. Càlcul de la concentració de S100A7 a partir de la recta patró de
proteïna recombinant amb el sandwich ELISA.
A) Relació entre la S100A7 recombinant aplicada a la recta patró i la densitat òptica
després de restar el soroll de fons. En gris, la zona lineal de la corba. B) Detall de la
zona lineal amb la que s’obté la fórmula de la regressió lineal.
Tenint en compte que en condicions no patològiques és possible trobar la proteïna en
sang a uns nivells aproximats de 300 ng/ml (Anderson et al., 2009) i que en condicions
patològiques, com el càncer, aquesta concentració es troba molt per sobre, la sensibilitat de
l’ELISA obtingut al nostre laboratori seria suficient per valorar la S100A7 com a biomarcador
tumoral.
4.4. Estudi de l’expressió de la S100A7 i el receptor RAGE a nivell
cel·lular
Amb l’objectiu d’escollir els models cel·lulars amb els que es realitzarà l’estudi de la
funció extracel·lular de la S100A7, es va voler caracteritzar l’expressió de la proteïna en les
102
Resultats
diferents línies de les que es disposava al laboratori, tant a nivell cel·lular com en els tumors
obtinguts a partir d’elles. La Taula 3 mostra el resultat dels estudis de western blot realitzats.
Taula 3. Expressió de S100A7 en diferents línies cel·lulars in vitro i in vivo.
Expressió S100A7
Expressió S100A7
cèl·lula
cèl·lula
tumor
+
+
+
+
-
ND
-
-
-
ND
-
ND
-
X
tumor
Càncer de pàncrees
MIA PaCa-2
BxPC-3
PANC-1
Càncer d'ovari
-
-
OVCAR-3
Càncer de pulmò
A549
Càncer de còlon
SW480
HT-29
HCT 116
Càncer de pròstata
+
-
+
-
PC-3
DU 145
Fibrosarcoma
Càncer de mama
MDA-MB-231
MDA-MB-468
T-47D
MCF-7
BT-474
HT1080
+++
+
-
++
Meduloblastoma
ND
Càncer de ronyò
ND
786-O
ND
Línies no tumorals
DAOY
Melanoma
MDA-MB-435
M21
Endotelial (HUVEC)
-
-
-
+++
Monòcit (THP1)
Fibroblast (BJ)
X
X
Carcinoma epidermoide
A431
Els símbols indiquen l’abs ència (-) o presència d’expressió de S100A7 a nivell baix (+ ),
mig (++) o alt (+++). En alguns casos, no va ser possible determinar l’ expressió in vivo de
la línia tumoral per falta de mat erial dis ponible (ND).
En el moment en què es va fer aquesta anàlisi, tan sols hi havia dos estudis que
mostraven que la proteïna S100A7 podia actuar com a factor atraient de leucòcits (Jinquan
et al., 1996; Wolf et al., 2008), però cap parlava del seu efecte sobre les cèl·lules tumorals o
endotelials a nivell extracel·lular. A nivell tumoral, únicament estava descrit que la línia
cel·lular de càncer de mama MDA-MB-231 transfectada amb S100A7 tenia una major
capacitat metastàtica (Emberley et al., 2005). Tenint en compte aquestes dades, ens vam
plantejar l’estudi de la funció extracel·lular de la proteïna en aquesta línia cel·lular. A més,
també es va seleccionar una altra línia tumoral de la mateixa indicació (càncer de mama
triple negatiu) però que expressés la S100A7 de manera endògena, com és la MDA-MB468. En aquesta línia cel·lular, es va veure que la transfecció amb un shRNA-S100A7 reduïa
la seva capacitat metastàtica (Paruchuri et al., 2008). Per últim, ens vam interessar pel fet
103
que la línia A431 només expressava la S100A7 in vivo, la qual cosa feia pensar que, sota
algunes condicions, la seva expressió era necessària per a la cèl·lula tumoral. Per tant,
també vam voler estudiar com responia aquesta línia a l’estímul amb la proteïna i aprofundir
en la regulació de la seva expressió a nivell cel·lular.
A més, per tenir una visió integrada de la funció de la S100A7 en el microentorn
tumoral, vam seleccionar, a banda de les línies tumorals, una línia cel·lular representativa de
cadascun dels compartiments que es troben dins el tumor com són les cèl·lules endotelials
(HUVEC), les cèl·lules immunes (THP1) i els fibroblasts (BJ).
Com s’ha dit abans, les proteïnes S100 son secretades a l’espai extracel·lular. Per
determinar si la línia tumoral MDA-MB-468 secreta la proteïna S100A7 al medi de cultiu es
va analitzar el sobrenedant de les cèl·lules utilitzant el sandwich ELISA prèviament
desenvolupat. A més, es van analitzar els sobrenedants de les línies MDA-MB-231, A431,
HUVEC, THP1 i BJ (que no expressen la proteïna in vitro) per confirmar els resultats
observats en l’anàlisi per western blot. Coincidint amb aquests resultats, es va veure que la
línia tumoral MDA-MB-468 secreta alts nivells de S100A7 al medi, mentre que no es va
observar presència de la proteïna al sobrenedant de les altres línies analitzades (Figura 11).
S100A7 secretada
(ng/ml)
150
125
100
75
50
25
B
J
P1
TH
VE
C
H
U
A
43
1
B
-4
68
A
-M
M
D
M
D
A
-M
B
-2
31
0
Figura 11. Quantificació de la secreció de S100A7 al medi de cultiu.
El sobrenedant de les línies cel·lulars indicades es va obtenir tal com es detalla a
l’apartat 3.3. i es va quantificar la S100A7 mitjançant el sandwich ELISA. El gràfic mostra
la mitjana ± SEM.
Un cop secretada a l’espai extracel·lular, alguns estudis mostren que la proteïna
S100A7 exerceix la seva funció via el receptor RAGE (Kataoka et al., 2012; Shubbar et al.,
2012). Per això, abans de veure quina resposta induïa la proteïna en les línies cel·lulars
seleccionades, vam voler determinar l’expressió d’aquest receptor in vitro. Com es mostra a
104
Resultats
la Figura 12, el receptor RAGE té una expressió molt diferent en les dues línies de càncer
BJ
THP1
HUVEC
A431
MDA-MB-468
MDA-MB-231
de mama escollides. A més, a la línia monocítica THP1 no es detecta presència del receptor.
42 kDa –
β-actina
93 kDa –
RAGE
Figura 12. Expressió de RAGE in vitro.
Anàlisi per western blot de l’expressió de RAGE en les línies cel·lulars indicades.
Aquesta expressió podria condicionar la resposta de les línies cel·lulars a l’estímul
amb S100A7.
4.5. Estudi d’interacció de la S100A7 amb el receptor RAGE
Després d'estudiar la utilitat dels nostres anticossos monoclonals com a eina de
recerca, ens vam plantejar una sèrie d’assaigs per tal de seleccionar els més eficaços en
bloquejar la funció extracel·lular de la S100A7.
Part d’aquesta eficàcia dependrà de si els anticossos bloquegen la interacció de la
proteïna amb el seu receptor. Tenint en compte això, vam voler desenvolupar al laboratori
un assaig senzill basat en la tècnica d’ELISA per estudiar la interacció S100A7-RAGE i
comprovar si els anticossos obtinguts eren capaços de bloquejar-la.
Aquests estudis van donar lloc a la publicació que es presenta a continuació, on es va
analitzar la unió de RAGE amb la S100A7 i amb altres membres de la família (la S100A4 i la
S100P), per als que ja s’havia descrit prèviament la seva interacció (Arumugam et al., 2006;
Siddique et al., 2013). A més, es va demostrar que aquest assaig era útil per testar l’eficàcia
de diferents agents inhibidors (molècules químiques o anticossos).
Padilla L, Dakhel S, Hernández JL. S100 to receptor for advanced glycation endproducts binding assay: looking for inhibitors. Biochem Biophys Res Commun. 2014
Mar 28;446(1):404-9. (Padilla et al., 2014).
105
106
Resultats
107
108
Resultats
109
110
Resultats
111
Aprofitant l’assaig desenvolupat, es va voler veure si els nostres anticossos eren
capaços de bloquejar la interacció de la S100A7 amb el receptor RAGE. Com es veu a la
Figura 13, la unió proteïna-receptor es veu reduïda en presència dels anticossos
monoclonals específics. El 5C3 (anti-S100A4) i el 2H8 (anti-S100P) es van utilitzar com a
controls negatius (C-).
120
110
5C3
C-
2H8
Interacció (%)
100
90
80
2G8
6E3
1E1
6F5
7H10
2D9
8H2
8B6
10G4
9F3
11D9
5E12
2H3
6E9
6E6
11B9
1
70
2
60
50
3
40
30
0
10
20
30
40
Anticòs monoclonal (nM)
Figura 13. Bloqueig de la interacció de S100A7 i RAGE amb els anticossos
obtinguts.
Sobre un recobriment de S100A 7 es van incubar durant 2 hores els anticossos indicats
abans d’afegir el receptor RAGE durant 48 hores. El % d’interacció indica la unió
específica del receptor, considerant la unió en absència d’anticòs com el 100%
d’interacció. El gràfic mostra la mitjana ± SEM.
En funció de l'eficàcia en bloquejar la interacció S100A7-RAGE, s’observen 3 nivells
de funcionalitat. Els anticossos 1E1 i 2G8 van ser el dos menys eficients, arribant a
bloquejar un 18,96% i un 26,41% de la interacció respectivament, a la màxima concentració.
A la Taula 4 es mostra el percentatge de bloqueig de la interacció per a cada anticòs a les 2
concentracions testades.
Tot i que amb aquest assaig podem fer-nos una idea de quins anticossos podrien ser
els més eficaços per bloquejar la funció extracel·lular de la proteïna S100A7, s’ha de tenir en
compte que és possible que la S100A7 faci el seu efecte a traves d'altres receptors a banda
de RAGE, com està descrit per a altres membres de la família (Cecil et al., 2009; Kang et al.,
2014; Kerkhoff et al., 2001). Per tant, vam decidir testar l’activitat dels anticossos a nivell
cel·lular per tenir més dades funcionals i seleccionar els millors candidats.
112
Resultats
Taula 4. Percentatge de bloqueig de la interacció S100A7-RAGE amb els
anticossos generats.
10 nM
30 nM
10 nM
30 nM
2D9
30,62
51,88
1E1
14,10
18,96
2H3
33,75
46,83
7H10
31,99
51,40
6E3
24,57
34,00
6E9
26,43
58,36
6F5
20,92
36,08
8H2
33,02
49,91
8B6
24,06
48,50
10G4
31,30
53,19
9F3
28,01
46,08
11B9
25,39
57,94
5E12
21,65
53,01
11D9
23,31
45,06
6E6
33,54
59,19
5C3
1,00
-7,53
2G8
13,96
26,41
2H8
-0,29
-7,64
4.6. Estudi del paper de la S100A7 in vitro
En aquesta part del treball, ens vam plantejar dos objectius principals. D’una banda,
vam voler determinar quina resposta induïa la S100A7 (proliferació, adhesió i migració)
sobre els diferents compartiments cel·lulars dins el tumor (cèl·lules endotelials, fibroblasts,
cèl·lules immunes i cèl·lules tumorals) i, d’altra banda, vam voler aprofitar aquells assaigs on
la proteïna jugava un paper rellevant per testar l'eficàcia dels anticossos monoclonals
obtinguts i seleccionar els candidats terapèutics.
4.6.1. Efecte de la S100A7 sobre la proliferació cel·lular
La proliferació cel·lular es un dels processos que es veu afectat durant la progressió
tumoral i una de les funcions on està descrit que poden participar alguns membres de la
família de les S100 (Chen et al., 2014a). Per exemple, el nostre grup va demostrar que la
S100P induïa la proliferació de la línia cel·lular humana de càncer de pàncrees BxPC3
(Dakhel et al., 2014). En el cas de la S100A7, un únic estudi demostrava que la proteïna
utilitzada extracel·lularment (a 70 nM) tenia un lleu però significatiu paper proliferatiu en
cèl·lules endotelials, actuant a través del receptor RAGE (Shubbar et al., 2012).
Davant d’aquests resultats, vam voler determinar si la proteïna S100A7 era capaç
d’induir una resposta proliferativa en diferents tipus cel·lulars. Amb aquest propòsit, vam
seleccionar dues línies de càncer de mama triple negatiu, la MD A-MB-468 (amb elevats
113
nivells d’expressió de S100A7) i la MDA-MB-231 (sense expressió de S100A7), a més de la
línia A431 (que expressa S100A7 in vivo però no en condicions normals de cultiu). A més,
també vam voler estudiar l'efecte sobre la línia endotelial HUVEC, la línia monocítica THP1 i
la línia fibroblàstica BJ, per oferir una visió integradora de l’entorn tumoral i tenir una primera
aproximació de si la proteïna actua via el mateix receptor (tenint en compte que la THP1 no
expressa RAGE).
Es van sembrar les cèl·lules en presència de diferents concentracions de S100A7 i es
va determinar el nombre de cèl·lules viables de 0 a 96 hores. A la Figura 14 es mostren els
resultats obtinguts per a cada línia cel·lular en les condicions definitives d’assaig. Com es
pot veure, la proteïna S100A7 no va induir en cap cas un augment del nombre de cèl·lules.
No obstant, per tal de treure conclusions fiables de l’efecte de la S100A7 sobre la
proliferació cel·lular, es van realitzar un gran nombre de variacions en les condicions
d’assaig, tal com es detallen a continuació.
MDA-MB-231
MDA-MB-468
0.7
0.9
0.6
0.8
OD (570 nm)
OD (570 nm)
0.7
0.5
0.4
0.3
0.2
0.6
0.5
0.4
0.3
0.2
0.1
0.1
0.0
0.0
0
25
50
75
100
0
25
Temps (h)
50
75
100
60
80
Temps (h)
A431
THP-1
0.9
1.4
0.8
1.2
OD (570 nm)
OD (570 nm)
0.7
1.0
0.8
0.6
0.4
0.5
0.4
0.3
0.2
0.2
0.1
0.0
0.0
0
25
50
75
0
100
20
40
Temps (h)
Temps (h)
0.6
114
Resultats
HUVEC
0.7
0.6
0.6
0.5
0.5
OD (570 nm)
OD (570 nm)
BJ
0.7
0.4
0.3
0.2
0.1
0.4
0.3
0.2
0.1
0.0
0.0
0
25
50
75
100
0
20
Temps (h)
40
60
80
Temps (h)
10% FCS
0 nM S100A7
10 nM S100A7
0 nM S100A7
3% FCS
10 nM S100A7
100 nM S100A7
100 nM S100A7
1000 nM S100A7
1000 nM S100A7
1% FCS
Figura 14. Efecte de la S100A7 sobre la proliferació cel·lular.
Efecte dosi-resposta de la S100A7 sobre la proliferació cel·lular al llarg del temps en les
línies cel·lulars indicades. El nombre de cèl·lules viables es va analitzar per tinció amb
MTT. Les corbes mostren la mitjana ± SEM.
D’una banda, es van utilitzar diferents concentracions basals de sèrum fetal en el medi
d’estímul per tal de tenir les cèl·lules en diferents estats d’activació i veure si aquest fet
afectava la seva capacitat de resposta a la proteïna S100A7. Com es pot observar a la
Figura 14, al 1% de FCS, les cèl·lules pràcticament no eren capaces d’arribar a duplicar en
nombre després de 72 hores de cultiu. Aquestes condicions dificultaven veure un efecte
inductor de la proteïna S100A7. Al 3% de FCS, en canvi, les cèl·lules adoptaven un
creixement exponencial (excepte en el cas de la HUVEC i la BJ), però tampoc es va
observar un resultat positiu davant l’estímul amb S100A7.
D’altra banda, es van fer variacions en el nombre de cèl·lules sembrades a l’inici de
l’assaig per tal d’afavorir la proliferació. En les condicions presentades a la Figura 14, les
cèl·lules es van sembrar a una confluència molt baixa, fet que dificultava que poguessin
dividir-se. No obstant, el fet de sembrar més cèl·lules tampoc va permetre observar un
efecte inductor per part de la S100A7, ni al 1 ni al 3% de FCS.
A més, quan la tècnica no és prou sensible o quan les línies cel·lulars amb les que
treballem proliferen molt lentament, és necessari sincronitzar les cèl·lules per poder veure
l’efecte proliferatiu d’alguns factors. Aquesta sincronització s’aconsegueix deprivant les
cèl·lules durant un temps determinat (entre 5 i 20 hores segons la línia cel·lular) amb medi
sol, per tal de que tot el cultiu quedi aturat en la fase G1 del cicle cel·lular o bé amb
115
inhibidors químics de la síntesi de DNA, arrestant les cèl·lules en fase S (Cobb, 2013). A
continuació, s’afegeix l’estímul corresponent i es revela de la forma habitual. Es va realitzar
aquest tipus d’estudi amb les línies cel·lulars indicades (20 hores de deprivació amb medi
sol), però tampoc es van obtenir resultats positius.
S’ha de tenir en compte que l’assaig utilitzat per valorar l’efecte de la proteïna
quantifica el nombre de cèl·lules viables a cada temps i en cada condició, sense diferenciar
entre cèl·lules quiescent/senescents i cèl·lules actives en divisió. L’assaig més utilitzat per
mesurar la proliferació real de les cèl·lules es basa en la mesura de la incorporació
d’uridines marcades (5-bromo-2’-deoxiuridines o BrdU), enlloc de les timidines, en el DNA de
nova síntesi durant la fase S del cicle cel·lular, de manera que el senyal obtingut és
proporcional al nombre de cèl·lules en divisió (Cobb, 2013). Tenint en compte aquest fet,
vam voler comprovar que l’absència d’increment en el nombre de cèl·lules viables observat
amb l’estímul de S100A7 es devia a que no augmentava el nombre de cèl·lules en divisió i
no a que es compensés un major nombre de cèl·lules amb una major mortalitat, donant com
a resultat el mateix valor per MTT que el medi sense estímul (basal) al final de l’assaig. Per
això, vam utilitzar el Cell Proliferation kit (GE Healthcare) que mesura la incorporació de
BrdU durant un temps determinat (entre 2 hores i tota la nit, segons la línia cel·lular). Com a
resultat, no es van veure diferències entre el basal i les cèl·lules estimulades amb S100A7,
per la qual cosa vam comprovar que la S100A7 no estava afectant el nombre de cèl·lules en
divisió.
Per tant, tot i el gran nombre de variacions en les condicions d’assaig, no es va
observar un augment de la proliferació cel·lular en resposta a la nostra proteïna recombinant
i amb les línies cel·lulars estudiades.
Si que es va observar, però, que a la concentració de 1000 nM i al 1% de FCS, les
cèl·lules presentaven una disminució significativa de la viabilitat. Aquest fenomen està
descrit per a altres membres de la família de les S100, com per exemple la S100A14, on
l’estímul en cèl·lules de la línia KYSE180 (cèl·lules de carcinoma escamós d’esòfag) amb
elevades concentracions de la proteïna (5 μM) induïa una disminució de la viabilitat cel·lular
per una acumulació d’espècies reactives d’oxigen (ROS) dins la cèl·lula i un augment de
l’activitat de les caspases (Jin et al., 2011). Un efecte similar es va observar en el cas de la
S100B, on l’estímul amb concentracions superiors a 100 nM en cèl·lules de mioblast, induïa
també un augment de la mort cel·lular per acumulació de ROS (Sorci et al., 2004). Per
determinar els mecanismes pels quals les cèl·lules veuen reduïda la seva viabilitat en
presència de S100A7 a elevades concentracions seria necessari fer estudis més profunds
116
Resultats
sobre les vies de senyalització activades en aquestes condicions de cultiu, on les cèl·lules
es troben a molt baixa confluència i on la presència de FCS juga un paper determinant.
D’altra banda, tenint en compte que està descrit que la sobreexpressió de S100A7 en
cèl·lules epitelials mamàries accelera el creixement de les cèl·lules tumoral de càncer de
mama implantades a la glàndula (Nasser et al., 2012), ens vam plantejar la possibilitat de
que la S100A7 estigués afectant la proliferació de la cèl·lula tumoral de manera indirecta. És
a dir, que la S100A7 secretada al microentorn tumoral induís, en altres tipus cel·lulars,
l’expressió de citoquines relacionades amb la proliferació de la cèl·lula tumoral.
Per veure si aquesta hipòtesi era certa, es van obtenir medis condicionats de les línies
THP1, BJ i HUVEC a les 48 hores de ser estimulades amb medi sol (CM_Basal) o amb la
proteïna S100A7 a 3 μM (CM_S100A7). A continuació, es va estimular la línia tumoral A431
amb els diferents medis condicionats i es va seguir el seu creixement al llarg del temps. Per
tal d’evitar la mort de les cèl·lules per falta de nutrients es va suplementar el medi
condicionat, de manera que quedés al 3% de FCS. Com es mostra a la Figura 15, els medis
condicionats amb S100A7 de les diferents línies no van induir una major proliferació de la
cèl·lula tumoral, comparat amb el medi condicionat basal.
HUVEC
BJ
1.4
1.2
1.6
1.2
1.0
1.4
1.2
1.0
0.8
0.6
0.4
OD (570 nm)
1.8
OD (570 nm)
OD (570 nm)
THP1
1.0
0.8
0.6
0.4
0.0
10 20 30 40 50 60 70 80
0
10 20 30 40 50 60 70 80
Temps (h)
0
10 20 30 40 50 60 70 80
Temps (h)
Temps (h)
CM_Basal
10% FCS
0.4
0.0
0.0
0
0.6
0.2
0.2
0.2
0.8
3% FCS
CM_S100A7
CM_Basal
0% FCS
CM_S100A7
Figura 15. Efecte dels medis condicionats sobre la proliferació de la línia A431.
Els medis condicionats de les línies indicades es van obtenir a les 48 hores d’estímul
amb medi sol (CM_Basal) o amb 3 μM de S100A 7 (CM_S100A 7) i es van utilitzar, sense
(0%) o amb FCS (3%), per estimular la proliferació de la línia tumoral A431. El nombre
de cèl·lules viables a cada temps es va valorar per MTT. El 10% de FCS es va utilitzar
com a control positiu.
117
En aquest cas, al 0% de FCS no es va observar un augment del nombre de cèl·lules al
llarg del temps en cap de les condicions testades, al igual que amb els medis condicionats al
3% de les línies BJ i HUVEC. El medi condicionat de la línia THP1 al 3%, en canvi, va induir
un increment del nombre de cèl·lules, tot i que no es van observar diferències entre el medi
basal i l’estimulat amb S100A7.
Amb aquests resultats, podem concloure que els factors que produeixen les línies
THP1, BJ i HUVEC en resposta a S100A7 no tenen una funció estimuladora de la
proliferació en la cèl·lula tumoral A431, en les condicions testades.
4.6.2. Paper de la S100A7 com a proteïna d’adhesió
Està descrit que alguns factors de creixement poden interaccionar directament amb
components de la matriu extracel·lular, protegint-se de la degradació o formant gradients de
concentració que dirigiran el moviment cel·lular cap a determinats llocs dins el teixit (Wilgus,
2012). Aquest fenomen pot ser important en processos com l’angiogènesi o la metàstasi
tumoral i durant la reparació de ferides (Lu et al., 2012).
Pel que fa a les proteïnes S100 existeixen pocs estudis sobre la seva capacitat per
unir-se a components de la matriu. Per exemple, s’ha vist que la S100A4 és capaç
d’interaccionar amb CCN3 (Li et al., 2002), una proteïna que, en ser secretada, pot unir-se a
molècules de la matriu com el perlecan o la vitronectina (Jun and Lau, 2011). Aquestes
dades suggereixen un possible mecanisme pel qual la S100A4 quedaria ancorada a la
matriu extracel·lular. En canvi, en el cas de la S100A7 no s’han realitzat estudis en aquest
sentit. Tot i això, ens vam plantejar la possibilitat de que la S100A7 també pogués quedar
unida a components de la matriu un cop és secretada i que els diferents tipus cel·lulars
puguin unir-se a aquesta proteïna per dirigir el seu moviment.
Per comprovar-ho, es va realitzar un assaig d’adhesió, utilitzant com a recobriment de
la placa un gradient de proteïna recombinant S100A7, i es va valorar el nombre de cèl·lules
adherides. Com es mostra a la Figura 16, de les sis línies cel·lulars estudiades, només
l’endotelial HUVEC i el fibroblast BJ van ser capaços d’adherir-se, de manera dosi-depenent,
sobre la matriu formada per S100A7, arribant a un màxim d’unió en els dos casos a la
concentració de 2.5 μM.
És possible que la unió es doni a traves d’un receptor de membrana, que
probablement no sigui RAGE, si tenim en compte els nivells d’expressió observats en les
línies estudiades (vegeu Figura 12 de Resultats). De ser RAGE, les línies tumorals MDAMB-231 i A431 també haurien d’haver presentat una unió similar a l’observada per a la
118
Resultats
HUVEC i la BJ. Per tant, estudis més profunds serien necessaris per identificar les proteïnes
de membrana diferencials entre les línies cel·lulars utilitzades i definir el possible mecanisme
a través del qual es dóna aquesta adhesió.
150
125
MDA-MB-231
Adhesió (%)
100
MDA-MB-468
A431
75
HUVEC
50
THP1
BJ
25
0
-25
-2.5
-2.0
-1.5
-1.0
-0.5
0.0
0.5
1.0
1.5
S100A7 (Log10 μM)
Figura 16. Efecte de la S100A7 com a proteïna d’adhesió.
Sobre recobriment de S 100A 7 a diferents concentracions, es van incubar les cèl·lules
indicades durant 4 hores i es va valorar el percentatge d’adhesió. Els valors obtinguts es
van normalitzar respecte del màxim efecte observat per a les línies HUVEC i BJ. El gràfic
mostra la mitjana ± SEM.
4.6.3. Efecte de la S100A7 sobre la mobilitat cel·lular
La capacitat de migrar de les cèl·lules dins el tumor és transcendental per a multitud
de processos. A més de ser clau en la capacitat metastàtica de la cèl·lula tumoral, és un
procés necessari per a la infiltració de cèl·lules del sistema immunitari o dels fibroblasts dins
del tumor i per que les cèl·lules endotelials puguin formar nous vasos sanguinis a mesura
que el tumor creix (Hanahan and Weinberg, 2011). L’enteniment del mecanisme pel qual les
cèl·lules migren i els factors que afavoreixen el seu moviment, permet el desenvolupament
d’estratègies terapèutiques innovadores per controlar, per exemple, les cèl·lules tumorals
invasives o l’angiogènesi.
S'ha descrit que alguns membres de la família de les proteïnes S100 (S100A1,
S100A2, S100A4, S100A6, S100A7, S100A8/S100A9, S100A10, S100A11, S100A12,
S100B i S100P) actuen com a factors quimiotàctics en diferents tipus cel·lulars (Gross et al.,
2014). En el cas de la S100A7, s’ha vist que pot actuar com a factor atraient de leucòcits a
través del receptor RAGE (Wolf et al., 2008), així com de limfòcits T i neutròfils (Jinquan et
119
al., 1996). A més, està descrit que indueix un augment de la migració en les cèl·lules
d’osteosarcoma Saos-2, també a través del receptor RAGE (Kataoka et al., 2012).
Tenint en compte aquestes dades i amb la intenció d’incrementar el coneixement de
l’activitat extracel·lular de la proteïna S100A7 en el procés migratori, vam plantejar estudis
de mobilitat utilitzant diferents models cel·lulars.
Per estudiar el seu efecte sobre la migració dirigida en cèl·lula tumoral, es va utilitzar el
sistema de transwell, fent servir la proteïna soluble com a agent quimiotàctic. A la Figura
17A es mostra el resultat obtingut per a la línia tumoral de càncer de mama MDA-MB-231.
En comparació amb les cèl·lules no estimulades, es va observar un augment dosi-depenent
estadísticament significatiu de la migració cel·lular, arribant a ser de 2.5 vegades a la
màxima dosi testada (3 μM).
Un cop confirmada la funció de la proteïna, es va escollir aquesta tècnica per valorar
l’eficàcia dels anticossos monoclonals obtinguts i seleccionar els millor, avançant així cap a
la identificació d’un candidat terapèutic. Es va seleccionar la dosi a la que es va observar el
màxim efecte (3 μM) i es va incubar la proteïna amb els anticossos corresponents a una
concentració suficient per assegurar el bloqueig complet de la S100A7 (9 μM). Després de
24 hores, es va analitzar el percentatge d’inhibició dels anticossos sobre l'efecte induït per la
proteïna. Com es veu a la Figura 17B, els anticossos 2G8 i 1E1, que havien estat els menys
funcionals en l'assaig d’interacció S100A7-RAGE per ELISA, van tornar a ser dels menys
funcionals (bloquejant tan sols un 24 i un 17% de l’efecte induït per la proteïna,
respectivament). Això ens va permetre confirmar la utilitat de l’ELISA d’interacció
desenvolupat com a eina per descartar, en una primera selecció, els anticossos menys
eficaços. A més, l'anticòs no relacionat (NR), que reconeix la proteïna S100P, no va tenir
cap efecte sobre la S100A7. Sis anticossos van destacar per la seva consistència en
bloquejar l'efecte de la proteïna (tots per sobre del 50% de bloqueig), per la qual cosa es van
seleccionar com a primers candidats funcionals: 2D9, 2H3, 6E3, 6F5, 8B6 i 9F3. A partir
d’aquests resultats, es va continuar treballant amb aquests sis anticossos per corroborar la
seva funcionalitat en diferents assaigs a nivell cel·lular.
D’altra banda, es va estudiar l’efecte de la proteïna sobre la migració de la línia tumoral
A431 (Figura 17C). En aquest cas, també es va observar un efecte inductor significatiu, tot i
que inferior a l’obtingut en la línia MDA-MB-231 a la mateixa dosi (3 μM), arribant a
augmentar 1.43 vegades la migració basal. Aprofitant aquest resultat, es van utilitzar els 6
anticossos seleccionats per bloquejar l’efecte de la proteïna, corroborant així l’eficàcia
observada en la línia MDA-MB-231. En aquest cas, tots van ser capaços de bloquejar el
100% de l’efecte induït per la proteïna.
120
Resultats
Per últim, es va voler veure si la S100A7 també era capaç d’induir la migració d’una
línia tumoral que ja expressés de manera endògena la proteïna, com és la MDA-MB-468
(Figura 17D). La proteïna S100A7, utilitzada a la concentració seleccionada prèviament (3
μM), va ser capaç d’augmentar de manera significativa la migració d’aquesta línia cel·lular
(1.94 vegades). A més, es va testar un dels sis anticossos candidats (el 6F5), per confirmar
novament el seu efecte neutralitzant. Com es mostra a la Figura 17D, el 6F5 bloqueja la
migració induïda, baixant fins i tot per sota de la migració basal. Aquest resultat es podria
explicar pel fet de que l’anticòs estigués bloquejant tant la proteïna recombinant afegida al
medi com la proteïna secretada per la pròpia cèl·lula (vegeu Figura 11 de Resultats). A més,
es veu un petit efecte de l’anticòs no relacionat (NR) que pot ser degut a que reconeix la
proteïna S100P, una proteïna que també és secretada per la línia MDA-MB-468 i que podria
tenir una influència sobre la migració cel·lular.
A la Figura 17E es mostra una imatge representativa de les cèl·lules migrades en
condicions basals, en presència de S100A7 a 3 μM o bé amb S100A7 junt amb l’anticòs
neutralitzant 6F5. Com es pot observar, la migració basal de la MDA-MB-231 és molt
superior a la de la MDA-MB-468, tot i que ambdues línies tumorals incrementen la seva
mobilitat de manera similar en resposta a la S100A7, tal com s’ha comprovat amb el
recompte del nombre de cèl·lules. En el cas de la A431, però, la quantificació es va realitzar
per superfície, ja que no era possible diferenciar el nombre de cèl·lules en els illots
característics d’aquesta línia cel·lular. La S100A7 va induir la formació d’illots més grans, la
qual cosa implica un augment important del nombre de cèl·lules migrades. Tot i això, a nivell
de superfície, aquest augment no es veu tan ben reflectit.
B
**
100
*
*
**
*
**
**
**
*
*
60
40
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
6E3
11D9
2G8
10G4
2H3
2D9
1E1
11B9
5E12
8H2
NR
3
mAb (9 μM):
6E6
0
S100A7 (μM):
6E9
3
6F5
1
7H10
0.3
8B6
0
--
20
10% FCS
0
S100A7 (μM):
80
**
***
***
200
ns
100
9F3
Migració (%)
***
300
ns
ns
**
400
ns
120
**
***
500
Migració (%)
A
121
D
C
**
300
225
***
ns
Migració (%)
Migració (%)
200
**
200
** **
100
* ** **
**
175
150
125
100
75
**
50
0
3
mAb (9 μM):
--
-- 2D9 2H3 6E3 6F5 8B6 9F3
E
3
3
3
3
3
S100A7
0
S100A7 (μM):
0
3
mAb (9 μM):
--
--
3
3
6F5 NR
S100A7 + mAb
A431
MDA-MB-468
MDA-MB-231
Basal
3
10% FCS
25
0
S100A7 (μM):
Figura 17. Efecte de la S100A7 sobre la migració de la cèl·lula tumoral i bloqueig
amb els anticossos monoclonals.
El resultat de la migració dirigida en trans well es va valorar per recompte cel·lular (MDAMB-231 i MDA -MB-468) o per superfície ocupada (A431) a les 24 hores d’estímul.
A) Migració dosi-depenent de la línia tumoral MDA-MB -231. B) Bloqueig de la migració
induïda per S100A 7 amb els anticossos anti-S100A 7 i l’anticòs no relacionat (NR),
utilitzat com a c ontrol negatiu. C) Migració induïda s obre la línia tumoral A431 i bloqueig
amb els anticossos monoclonals seleccionats. D) Migració induïda sobre la línia tumoral
MDA-MB -468 i bloqueig amb l’anticòs 6F5 i el no relacionat (NR). E) Imatge
representativa de les cèl·lules migrades sota les condiciones indicades. Els gràfics
mostren la mitjana ± SEM. Test U de Mann-Whitney ns p>0.05, *p< 0.05, **p<0.01,
***p<0.001.
122
Resultats
D’altra banda, per estudiar si la S100A7 pot tenir un paper en el reclutament de les
cèl·lules immunes cap a l’interior del tumor, es van seleccionar els monòcits THP1 i es va
utilitzar un sistema transwell adaptat per a cèl·lules no adherents. Com es veu a la Figura
18A, la S100A7 va induir un augment estadísticament significatiu de la migració de la THP1,
de manera dosi-depenent, arribant a un increment de 2.70 vegades a 3 μM i de 3.45
vegades a la màxima dosi testada (10 μM).
Degut a l’origen bacterià de la S100A7, hi havia nivells detectables d’endotoxines que
es van arrossegar després de la seva purificació (vegeu apartat 4.1). Per això, era important
comprovar que l’efecte induït per la proteïna recombinant era degut a la S100A7 i no a les
endotoxines, sobretot en una línia tan sensible al LPS com és la THP1. Es va estudiar
l’efecte del LPS sobre la migració dels monòcits a una concentració equivalent a les
endotoxines presents en 3 μM de proteïna recombinant (13.5 ng/ml de LPS). A més, com a
control addicional, vam voler veure si la polimixina B, un bloquejant de l’acció de les
endotoxines (Bannatyne et al., 1977), tenia un efecte inhibitori sobre l’acció de la S100A7 i
del LPS. Com es veu a la Figura 18B, el LPS va augmentar lleugerament la migració de la
línia THP1, tot i que no de manera significativa, i, a més, la polimixina B va reduir el seu
efecte fins a nivells basals. La S100A7, en canvi, va augmentar de manera significativa la
migració de les THP1 (2.7 vegades) i es va veure lleugerament afectada per la polimixina B,
una reducció equivalent a l’augment induït pel LPS. Aquests resultats confirmen que l’efecte
observat es deu a la S100A7 recombinant i no a la presència d’endotoxines a la mostra.
Per últim, vam voler confirmar la funcionalitat dels anticossos monoclonals
seleccionats. Per això, es va seleccionar la concentració de 3 μM de S100A7, ja que és
suficient per veure un efecte inductor important, i es va preincubar amb els anticossos
monoclonals, com s’ha explicat anteriorment. Com a resultat, els sis anticossos seleccionats
van inhibir de manera significativa la resposta a la S100A7 (tots ells per sobre del 40% de
bloqueig), mentre que l’anticòs no relacionat (NR), que reconeixia la S100P, no va tenir
efecte (Figura 18C).
123
900
Migració (%)
800
350
600
500
***
400
***
300
ns
200
250
200
150
100
50
100
0
1
C
3
10
10% FCS
0
S100A7 (μM):
ns
**
300
700
ns
ns
B
***
Migració (%)
A
0
S100A7 (μM):
0
3
3
LPS (ng/ml):
0
0
0 13.5 13.5
Polimixina (μg/ml):
0
0
100
0
0
0
100
ns
120
Migració (%)
100
80
** ** **
60
**
**
40
20
**
2H3
3
3
3
3
NR
2D9
3
9F3
3
8B6
3
6F5
3
mAb (9 μM):
6E3
S100A7 (μM):
--
0
Figura 18. Efecte de la S100A7 sobre la migració del monòcit THP1.
El resultat de la migració dirigida en trans well es va valorar per recompte cel·lular a les 4
hores d’estímul. A) Migració dosi-depenent induïda per la S100A7. B) Efecte de la
S100A7 i del LPS en presència i en absència del bloquejant d’endotoxines polimixina B.
C) Bloqueig de la migració induïda per 3 μM de S 100A 7 amb els anticossos ant i-S100A7
seleccionats (9 μM) i l’anticòs no relacionat (NR), utilitzat com a control negatiu. El gràfics
mostren la mitjana ± SEM. Test U de Mann-Whitney ns p>0.05, **p< 0.01, ***p<0.001.
Veient el paper promigratori de la S100A7 per a altres tipus cel·lulars, ens vam
plantejar la possibilitat de que aquesta proteïna també pogués induir la migració dels
fibroblasts. Per comprovar-ho, es van realitzar estudis utilitzant el sistema transwell tal com
es va fer per a les cèl·lules tumorals. Com es veu a la Figura 19A, la S100A7 va induir un
augment significatiu de la migració de les BJ (2.05 vegades respecte del basal). A més,
l’anticòs 6F5 va bloquejar per sobre del 70% l’efecte induït per la proteïna, confirmant
novament la seva eficàcia. La Figura 19B mostra una imatge representativa de les cèl·lules
migrades en cadascuna de les condicions assajades.
124
Resultats
A
250
B
**
Basal
Migració (%)
200
S100A7
S100A7 + 6F5
**
150
100
50
0
S100A7 (μM):
0
3
mAb (9 μM):
--
-- 6F5
3
Figura 19. Efecte de la S100A7 sobre la migració del fibroblast i bloqueig amb
l’anticòs 6F5.
El resultat de la migració dirigida en trans well es va valorar per recompte cel·lular a les
24 hores d’estímul. A) Migració induïda en resposta a la proteïna S 100A7 i bloqueig amb
l’anticòs monoclonal 6F5. B) Imat ge repres entativa de les cèl·lules migrades sota les
condiciones indicades. El gràfic mostra la mitjana ± SEM. Test U de Mann-Whitney
**p<0.01.
Com s’ha explicat abans, les cèl·lules endotelials necessiten moure’s per formar nous
vasos sanguinis dins el tumor i ajudar al seu creixement (angiogènesi). Alguns membres de
la família de les S100 han estat relacionats amb aquest procés, com per exemple la
S100A4. Aquesta proteïna per sí sola no té efecte, però és capaç d’augmentar de manera
sinèrgica l’efecte del VEGF sobre la migració de la HUVEC, uns resultats publicats pel
nostre grup (Hernandez et al., 2013). Pel que fa a la S100A7, s’ha vist que, a banda
d’augmentar la proliferació de les cèl·lules endotelials, indueix la formació de tubs capil·lars
en HUVEC (Shubbar et al., 2012).
Amb aquests indicis i veient els resultats obtinguts en els altres tipus cel·lulars, ens
vam plantejar la possibilitat de que la proteïna pogués induir la migració de les cèl·lules
endotelials. A més, vam voler comprovar si la S100A7 també tenia un efecte sinèrgic sobre
l’acció del VEGF. Com es mostra a la Figura 20A, a diferència de la S100A4, la S100A7
utilitzada a la mateixa concentració (1 μM) sí que augmenta significativament la migració de
les cèl·lules endotelials HUVEC per sí sola (fins a 1.9 vegades per sobre de la migració
basal). La combinació amb el VEGF va donar com a resultat la suma de l’efecte de cada
proteïna per separat, de manera que no es va observar un efecte sinèrgic, sinó additiu.
D’altra banda, es va bloquejar l’efecte inductor de la S100A7 amb l’anticòs 6F5, obtenint
pràcticament un 100% d’inhibició i corroborant els resultats previs (Figura 20B). A la Figura
20C es mostra una imatge representativa de les cèl·lules migrades sota les condicions de
cultiu indicades.
125
A
B
500
250
**
***
300
200
***
***
100
150
*
100
0
10
0
10
S100A7 (μM):
0
0
1
1
Basal
10% FCS
50
0
VEGF (ng/ml):
C
***
200
Migració (%)
Migració (%)
400
S100A7
0
S100A7 (μM):
0
1
mAb (3 μM):
--
-- 6F5
1
S100A7 + 6F5
Figura 20. Efecte de la S100A7 sobre la migració de la cèl·lula endotelial.
El resultat de la migració dirigida en trans well es va valorar per recompte cel·lular a les
24 hores d’estímul. A) E fecte de la S 100A7 en combinació amb el VEGF. B) Bloqueig de
l’efecte de la proteïna amb l’anticòs monoclonal 6F5. C) Imatge represent ativa de les
cèl·lules migrades sota les condiciones indicades . El gràfic mostra la mitjana ± SEM. Test
U de Mann-Whitney *p<0. 05, **p<0. 01, ***p< 0.001.
Un altre assaig àmpliament utilitzat per estudiar la capacitat migratòria de les cèl·lules
és el wound healing o reparació de ferida. Es van optimitzar les condicions de deprivació i el
temps de reparació per a la línia cel·lular HUVEC i es va observar que la S100A7 era capaç
d’induir de manera dosi-depenent la reparació de la ferida practicada sobre la monocapa, ja
a baixa concentració (300 nM), arribant a augmentar 2.31 vegades l’efecte observat en el
basal, a la màxima concentració utilitzada (Figura 21A). Aprofitant aquest assaig, es van
voler testar els anticossos seleccionats contra la S100A7 per corroborar la seva eficàcia. Es
va seleccionar la concentració de 1 μM de S100A7, ja que era suficient per veure un efecte
clar de la proteïna (2.04 vegades superior al valor basal) i es va bloquejar amb 3 μM dels
anticossos seleccionats. Com es mostra a la Figura 21B, els sis anticossos seleccionats van
ser capaços de bloquejar significativament l’efecte induït per la proteïna S100A7.
126
Resultats
B
A
500
400
300
***
200
**
*
100
0
S100A7 (μM):
250
Reparació de la ferida
(%)
***
**
200
150
** *
*
*
**
**
100
50
0
0
0.3
1
3
10% FCS
Reparació de la ferida
(%)
600
S100A7 (μM):
0
1
mAb (3 μM):
--
-- 2D9 2H3 6E3 6F5 8B6 9F3
1
1
1
1
1
1
Figura 21. Efecte de la S100A7 sobre la reparació de ferida en cèl·lula endotelial.
A) E fecte dosi-depenent de la S100A7 sobre la reparació de la ferida practicada sobre
monocapa de HUVECs després de 20 hores de deprivació i 24 hores de migració.
B) Bloqueig amb els anticossos anti-S100A7 sobre la reparació de ferida induïda per part
de la S100A7. Els gràfics mostren la mitjana ± SEM. Test U de Mann-Whitney *p<0.05,
**p<0.01, ***p<0.001.
Amb aquests resultats s’ha demostrat que la proteïna S100A7 té una marcada funció
promigratòria en els diferents tipus cel·lulars estudiats. Aquest fet, reforça la hipòtesis de
que la proteïna extracel·lular juga un paper important en el desenvolupament tumoral,
afavorint la metàstasi, l’angiogènesi i el reclutament de cèl·lules immunitàries i fibroblasts
dins els tumor, de manera que la S100A7 seria una bona diana contra la que dirigir una
teràpia. A més, s’han obtingut anticossos monoclonals capaços de bloquejar el seu efecte i
que, per tant, són bons candidats terapèutics per al tractament de malalties relacionades
amb la proteïna.
Com s’ha explicat anteriorment, alguns estudis han suggerit que l’efecte promigratori
de la S100A7 es dóna a través del receptor RAGE. Tenint en compte els nostres resultats,
és possible que RAGE no sigui l’únic receptor implicat en la migració induïda per la S100A7,
ja que la línia cel·lular THP1 no expressa aquest receptor, tal com hem vist a l’apartat 4.4.
Per tant, un estudi més profund mitjançant l’ús d’inhibidors químics específics, anticossos
bloquejants o shRNAs, seria necessari per determinar els receptors implicats en la resposta
a S100A7 en cadascun dels tipus cel·lulars analitzats.
127
4.6.4. Estudi d’adhesió de la cèl·lula immunitària sobre la cèl·lula endotelial
L’expressió en membrana de determinades proteïnes d’adhesió per part de les
cèl·lules endotelials que formen els vasos sanguinis dins el tumor és determinant per a
l’extravasació de diferents tipus cel·lulars cap al microentorn tumoral (Kobayashi et al.,
2007). Està descrit que determinats factors influeixen en l’expressió d’aquestes proteïnes de
membrana, afectant així la capacitat de les cèl·lules circulants, com poden ser els monòcits,
per adherir-se a l’endoteli (Goda et al., 2000; Zhang et al., 2011b). En un intent de simular
aquesta situació in vitro, s’ha utilitzat en multitud de publicacions un assaig d’adhesió de la
cèl·lula monocítica (THP1) sobre la monocapa de cèl·lula endotelial (HUVEC), demostrant
en molts casos l’efecte que tenen factors com el TNFα o el LPS activant la monocapa de
HUVEC i augmentant, en conseqüència, l’adhesió de les cèl·lules THP1 (Gupta et al., 2005;
Ramana et al., 2004). Estudis més profunds a nivell d’expressió de proteïnes de membrana,
van demostrar que l’activació de la monocapa de HUVEC donava com a resultat un augment
de l’exposició en membrana de determinades proteïnes d’adhesió, com la ICAM-1 o la
VCAM-1, que afavorien la interacció de la cèl·lula THP1 (Ramana et al., 2004).
En base a aquestes observacions, i veient que la proteïna S100A7 té un paper
important en el moviment de diferents tipus cel·lulars, entre ells la HUVEC i la THP1, ens
vam plantejar la possibilitat de que aquesta proteïna, quan es troba al microentorn tumoral,
pugui estar activant la cèl·lula endotelial de manera que faciliti l’extravasació de determinats
tipus cel·lulars cap al tumor. En aquest sentit, es va posar a punt l’assaig d’adhesió de
cèl·lules THP1 sobre monocapa de HUVEC, utilitzant com a control positiu el TNFα. A més,
donat el paper descrit per a les endotoxines induint l’activació de la monocapa de HUVEC,
vam utilitzar un control amb concentracions equivalents de LPS per tal de comprovar si
l’efecte observat era degut a la S100A7 o a les endotoxines presents en la proteïna
recombinant. Com es mostra a la Figura 22A, tant la proteïna S100A7 com el LPS van
induir una activació significativa de la monocapa de HUVEC després de 48 hores d’estímul,
afavorint l’adhesió de les cèl·lules THP1. Si comparem l’efecte obtingut per la S100A7 amb
l’efecte a la concentració equivalent de LPS, no hi ha diferències significatives, per la qual
cosa podem concloure que l’efecte observat amb la S100A7 es deu a les endotoxines
presents i no a la proteïna. El TNFα, en canvi, va augmentar de manera important (fins a 4.2
vegades) l’adhesió dels monòcits, tal com està descrit a la bibliografia.
En aquest primer assaig, la S100A7 era retirada del medi després de 48 hores
d’estímul de la monocapa de HUVEC i, posteriorment, s’afegien els monòcits, de manera
que la proteïna no arribava a estar en contacte amb les cèl·lules immunes en cap moment.
No obstant, en un tumor, la S100A7 del microentorn entra en contacte amb l’endoteli i també
128
Resultats
amb les cèl·lules circulants, ja que arriba a torrent sanguini a través dels vasos. Per tant, per
simular aquesta situació in vitro era necessari posar en contacte amb la S100A7 tant les
cèl·lules endotelials com les cèl·lules circulants. Tenint en ment aquesta idea, es va posar a
punt un assaig on es sembraven les THP1 sobre la monocapa de HUVEC en presència de
S100A7 a diferents concentracions i es deixaven adherir durant 4 hores. Com en el cas
anterior, es va utilitzar el control de LPS, per confirmar que l’efecte era específic de la
S100A7, i el TNFα com a control positiu. Com a resultat, la S100A7 va induir un augment
significatiu dosi-depenent de l’adhesió de la THP1 a la monocapa de HUVEC, arribant a
augmentar 3.55 vegades l’adhesió basal a la màxima dosi testada. El LPS, en canvi, va tenir
un efecte significativament inferior a les concentracions equivalents (Figura 22B).
B
***
600
400
200
200
ns
*** ***
ns
*
150
*
** ***
100
50
0
S100A7 (μM):
***
500
ns
Cèl·lules adherents
(%)
Cèl·lules adherents
(%)
A
0
0.1
0
1
0
10
0
***
***
400
**
ns
300
**
200
***
**
*
***
100
0
0
S100A7 (μM):
0
0.1
0
1
0
10
0
0
LPS (ng/ml):
0
0
0.5
0
5
0
50
0
TNFD
D (ng/ml):
0
0
0
0
0
0
0
10
LPS (ng/ml):
0
0
0.5
0
5
0
50
0
TNFD (ng/ml):
0
0
0
0
0
0
0
10
Figura 22. Estudi de l’adhesió de THP1 sobre monocapa de HUVEC.
A) La monocapa de HUVEC es va estimular durant 48 hores en les condicions indicades.
A continuació, es van afegir les cèl·lules THP1 marcades en medi sol i es van deixar
adherir durant 1 hora. B) Sobre la monocapa de HUVE C es van afegir les THP1
marcades en presència dels estímuls indicats i es va n deixar adherir durant 4 hores. Les
gràfiques mostren la mitjana ± SEM. Test U de Mann-Whitney ns p>0.05, *p<0.05,
**p<0.01, ***p<0.001.
Amb aquests resultats podem hipotetitzar que la S100A7 indueix l’adhesió dels
monòcits a la monocapa endotelial participant físicament en la unió cèl·lula-cèl·lula i no de
manera indirecta, per un augment de l’expressió en membrana de proteïnes d’adhesió. En
concordança amb aquesta hipòtesi, s’ha vist que l’heterodímer S100A8/S100A9 es diposita
sobre l’endoteli, unint-se a estructures de tipus heparan sulfat presents als proteoglicans de
la seva superfície (Robinson et al., 2002). La presència d’aquest complex a l’interior dels
vasos dels teixits amb inflamació local ajuda a l’adhesió i extravasació d’altres tipus
cel·lulars, que expressen receptors per a aquestes proteïnes, com ara leucòcits. Estudis
129
més profunds serien necessaris per determinar si l’efecte observat amb la S100A7 es dóna
per mecanismes similars.
4.6.5. Estudi dels factors regulats per la S100A7
Les proteïnes S100, com altres proteïnes que es troben secretades al microentorn
tumoral, actuen a nivell cel·lular, no només induint una resposta, com pot ser una major
capacitat proliferativa o migratòria, si no també fent que es secretin multitud de citoquines
que potencien l’efecte de l’activador inicial. Comença així una cascada de respostes a
diferents factors que, en darrer terme, creen l’ambient idoni per que la cèl·lula tumoral tingui
èxit en la seva progressió. En aquest sentit, l’estudi de les proteïnes que s’expressen en
resposta a l’estímul amb S100A7 és clau per entendre el seu mecanisme d’acció a nivell
cel·lular i com aquesta proteïna pot contribuir al creixement tumoral, l’angiogènesi i la
metàstasi.
4.6.5.1.
Anàlisi de les citoquines secretades en resposta a la S100A7
Per avaluar com es veu afectat el microambient tumoral en resposta a la S100A7, vam
analitzar la secreció de múltiples factors per part dels quatre tipus cel·lulars amb els que
hem treballat (tumoral, endotelial, immune i fibroblast) en presència i en absència de la
proteïna.
Es va escollir un array de membrana amb 43 citoquines i factors de creixement
(Figura 23A) i es va comparar el patró d’expressió al sobrenedant de cèl·lules estimulades ,
a les 48 hores, amb LPS a 13.5 ng/ml (Basal), front el de cèl·lules estimulades amb S100 A7
a 3 μM.
Per a l’estudi de l’efecte sobre la línia tumoral, es va seleccionar la línia A431, ja que
prèviament havia mostrat una bona resposta a la proteïna S100A7 (augmentant la seva
migració) i, a més, serà el model escollit pels estudis d’eficàcia in vivo. La Figura 23B
mostra el patró d’expressió dels diferents factors en el medi basal i en el medi estimulat amb
S100A7. Després de normalitzar la intensitat de cada spot entre els valors dels controls
positius presents a la membrana, es va obtenir el valor de densitat relativa per a cada
proteïna (Figura 23C). Com es pot observar, la línia tumoral secreta a nivell basal un gran
nombre de citoquines. El factor GM-CSF va ser el que es va veure més augmentat per
l’estímul amb S100A7 (2.95 vegades), seguit de l’interferó gamma (2.62 vegades) i el GRO
(també anomenada CXCL1) (2.43 vegades). A més, un gran nombre de citoquines van
incrementar la seva secreció de manera lleugera però significativa (ENA-78, PECAM-1, IL-6,
130
Resultats
Leptina, angiopoietina 2, MPC-4, etc.). Tot i això, s’ha de tenir en compte que alguns dels
factor que mostren un canvi relatiu important amb l’estímul de S100A7, tenen una expressió
molt baixa en les dues condicions de cultiu, com és el cas de l’interferó gamm a. Per últim, hi
van haver algunes citoquines que no es van veure afectades de manera significativa per la
presència de S100A7 (PDGF-BB, VEGF-D, MCP-1, angiogenina, etc.).
Aquest mateix estudi es va realitzar amb les cèl·lules de la línia THP1. Com es mostra
a la Figura 24, la cèl·lula monocítica secreta de manera basal un nombre de citoquines
inferior al de la cèl·lula tumoral, de manera que 10 de les 43 citoquines no es van poder
quantificar. Tot i això, els canvis induïts per la S100A7 van ser de més magnitud en la
majoria de casos. Per exemple, es va observar un gran augment de la secreció del factor
GRO (per sobre de 40 vegades), així com del TNFα (per sobre de 30 vegades ). A més,
també van incrementar de manera important factors com la IL-6 o el MCP-4, tot i que en
aquests casos l’expressió en les dues condicions de cultiu era molt baixa, la qual cosa
dificultava la seva valoració. Altres citoquines que van augmentar significativament en
resposta a l’estímul van ser la IL-1β, la MMP-9, la Leptina, el VEGFR2 o el I-309. En canvi,
alguns factors, com per exemple el plasminogen (PLG), el bFGF, el VEGF o les interleukines
2 i 4, no van variar la seva secreció. Cal remarcar, en aquest cas, que la S100A7 va induir
un augment de la MMP-9 i una disminució dels TIMPs, que podria estar en concordança
amb la inducció de la migració observada prèviament. En canvi, en la línia tumoral la MMP9
va augmentar lleugerament i els TIMPs pràcticament no es van veure afectats. Un altre fet
rellevant va ser que, mentre que en la línia tumoral el GM-CSF era el factor que més
augmentava, en la línia monocítica no va ser possible quantificar-lo. En canvi, el TNFα, que
no va variar de manera significativa en la cèl·lula tumoral, va ser un dels factors que més va
estimular-se en la línia monocítica. Aquests resultats donen una idea de la diversitat de
respostes que pot induir la proteïna S100A7 en funció del tipus cel·lular i de les seves
característiques intrínseques.
Un efecte addicional important que vam observar amb l’estímul de la línia THP1, va
ser un canvi morfològic d’algunes cèl·lules, que van passar de créixer en suspensió, a
adherir-se al fons del pou, adoptant una morfologia semblant a la dels macròfags (Figura
25). Una dada que suportaria la hipòtesi de que la proteïna S100A7 indueix un procés de
diferenciació dels monòcits a macròfags és la sobreexpressió de factors com GRO, MCP-1 i
MMP-9 observada anteriorment, ja que són citoquines associades al fenotip de macròfags
de tipus M2 (protumorals) (Bettum et al., 2014).
131
A
B
Human Angiogenesis Antibody Array C1
B
C
D
E
F
G
H
POS
NEG
NEG
ANG
EGF
ENA-78
bFGF
2
POS
POS
NEG
NEG
ANG
EGF
ENA-78
bFGF
3
GRO
IFNγ
IGF-1
IL-6
IL-8
Leptin
MCP-1 PDGF-BB
4
GRO
IFNγ
IGF-1
IL-6
IL-8
Leptin
MCP-1 PDGF-BB
5
PLGF
RANTES
TGFβ1
TIMP-1
TIMP-2
THPO
VEGF
VEGF-D
6
PLGF
RANTES
TGFβ1
TIMP-1
TIMP-2
THPO
VEGF
VEGF-D
7
B LA NK
B LA NK
B LA NK
B LA NK
B LA NK
B LA NK
NEG
POS
8
B LA NK
B LA NK
B LA NK
B LA NK
B LA NK
B LA NK
NEG
POS
2
A
B
C
D
G
H
POS
POS
NEG
NEG
ANGPT1 ANGPT2
E
F
PLG
Endostatin
POS
POS
ANGPT1 ANGPT2
PLG
Endostatin
NEG
NEG
3
G-CSF GM-CSF
I-309
IL-10
IL-1 α
IL-1 β
IL-2
IL-4
4
G-CSF GM-CSF
I-309
IL-10
IL-1 α
IL-1 β
IL-2
IL-4
5
I-TAC
MCP-3
MCP-4
MMP-1
MMP-9 PECAM-1
TIE-2
TNFα
6
I-TAC
MCP-3
MCP-4
MMP-1
MMP-9 PECAM-1
TIE-2
TNFα
7
uPAR
VEGFR2 VEGFR3
B LA NK
B LA NK
B LA NK
B LA NK
POS
8
uPAR
VEGFR2 VEGFR3
B LA NK
B LA NK
B LA NK
B LA NK
POS
C
IFNg
GRO
ENA-78
IL-6
Leptin
PLGF
bFGF
IL-8
IGF-1
THPO
EGF
VEGF
TIMP-1
TIMP-2
TGF-b
ANG
MCP-1
VEGF-D
PDGF-BB
RANTES
Promig
2,624
2,431
2,048
1,996
1,679
1,654
1,622
1,607
1,385
*
*
ns
*
ns
1,231
1,154
1,113
1,105
1,098
1,071
1,054
0,985
0,957
0,756
ns
ns
ns
ns
ns
*
Promig
GM-CSF
PECAM-1
ANGPT2
MCP-4
I-TAC
I-309
PLG
IL-1 alpha
IL-1 beta
ns
IL-2
MCP-3
MMP-9
TIE-2
VEGFR3
MMP-1
VEGFR2
ANGPT1
TNFalpha
uPAR
Endostatin
IL-4
G-CSF
Membrana C1
IL-10
*
*
*
*
2,124
Membrana C2
Human Angiogenesis Antibody Array C2
1
S100A7
Membrana C1
Basal
A
POS
1
*
*
*
*
0.0 0.5 1.0 1.5 2.0 2.5 3.0 3.5
2,954
2,116
1,776
1,762
1,686
1,658
1,586
1,579
1,573
1,526
1,485
1,446
*
*
*
ns
1,377
1,292
1,210
1,190
1,180
1,160
*ns
1,127
ns
1,123
-
ND
ND
Membrana C2
0.0 0.5 1.0 1.5 2.0 2.5 3.0 3.5
Densitat relativa
Densitat relativa
(increment front el Basal)
(increment front el Basal)
Figura 23. Anàlisi per array de les citoquine s secretade s per la línia tumoral A431
en presència de S100A7.
El sobrenedant de les c èl·lules tumorals A 431 es va analitzar a les 48 hores d’estímul
amb LPS a 13.5 ng/ml (B asal) o amb S100A7 a 3 μM. A) Esquema de les membranes de
RayBio® C-S eries Human Angiogenesis Array 1000. B) Expressió diferencial del
sobrenedant en les condicions de cultiu indicades. C) Densitat relativa per a cada
citoquina obtinguda en dividir la intensitat en píxels en presència de S100A7 entre la
intensitat en píx els en el medi bas al. Els controls positius (POS) es va n utilitzar per
normalitzar. En alguns casos no es va detectar senyal (ND). El gràfic mostra la mitjana ±
SEM. Test U de Mann-Whitney ns p>0.05, *p<0.05.
132
*
ns
ns
ns
1,209
-
*
*
ns
*
*
*
*
*
*
*
Resultats
A
B
Human Angiogenesis Antibody Array C1
A
B
C
D
E
F
G
H
POS
POS
NEG
NEG
ANG
EGF
ENA-78
bFGF
ENA-78
bFGF
2
POS
POS
NEG
NEG
ANG
EGF
3
GRO
IFNγ
IGF-1
IL-6
IL-8
Leptin
MCP-1 PDGF-BB
4
GRO
IFNγ
IGF-1
IL-6
IL-8
Leptin
MCP-1 PDGF-BB
5
PLGF
RANTES
TGFβ1
TIMP-1
TIMP-2
THPO
VEGF
VEGF-D
6
PLGF
RANTES
TGFβ1
TIMP-1
TIMP-2
THPO
VEGF
VEGF-D
7
B LA NK
B LA NK
B LA NK
B LA NK
B LA NK
B LA NK
NEG
POS
8
B LA NK
B LA NK
B LA NK
B LA NK
B LA NK
B LA NK
NEG
POS
Basal
2
A
B
C
D
G
H
POS
POS
NEG
NEG
ANGPT1 ANGPT2
E
F
PLG
Endostatin
POS
POS
ANGPT1 ANGPT2
NEG
NEG
PLG
Endostatin
3
G-CSF GM-CSF
I-309
IL-10
IL-1 α
IL-1 β
IL-2
IL-4
4
G-CSF GM-CSF
I-309
IL-10
IL-1 α
IL-1 β
IL-2
IL-4
5
I-TAC
MCP-3
MCP-4
MMP-1
MMP-9 PECAM-1
TIE-2
TNFα
6
I-TAC
MCP-3
MCP-4
MMP-1
MMP-9 PECAM-1
TIE-2
TNFα
7
uPAR
VEGFR2 VEGFR3
B LA NK
B LA NK
B LA NK
B LA NK
POS
8
uPAR
VEGFR2 VEGFR3
B LA NK
B LA NK
B LA NK
B LA NK
POS
C
GRO
IL-6
Leptin
IFNgamma
MCP-1
EGF
ANG
IL-8
RANTES
VEGF-D
VEGF
bFGF
TIMP-2
TIMP-1
THPO
TGF-b
PLGF
PDGF-BB
IGF-1
ENA-78
41,921
8,384
2,160
1,007
*
*
*
*
*
*
*
ns
0,927
ns
0,868
*
*ND
2,070
2,051
1,620
1,266
1,144
1,076
0,754
-
*
*
ND
ND
ND
ND
ND
-
0
2
4
Promig
TNFalpha
MCP-4
IL-1 beta
MMP-9
VEGFR2
I-309
VEGFR3
IL-1 alpha
MCP-3
I-TAC
MMP-1
ANGPT2
Endostatin
IL-2
IL-4
PECAM-1
PLG
TIE-2
uPAR
IL-10
GM-CSF
G-CSF
Membrana C1
ANGPT1
Promig
3,260
Membrana C2
Human Angiogenesis Antibody Array C2
1
6
8
S100A7
Membrana C1
1
*
10 10 60
31,302
9,611
*
*
9,421
3,292
*
*
*
*
*
*
*
*
*
*ns
2,557
2,317
1,859
1,659
1,652
1,464
1,439
1,303
1,239
1,086
ns
ns
ns
1,067
1,020
0,979
*
*ND
0,912
0,814
-
ND
ND
ND
-
0
2
Membrana C2
4
6
8
10 10 40
Densitat relativa
Densitat relativa
(increment front el Basal)
(increment front el Basal)
Figura 24. Anàli si per array de les citoquine s secretades per la línia monocítica
THP1 en presència de S100A7.
El sobrenedant de les cèl·lules THP1 es va analitzar a les 48 hores d’estímul amb LPS a
13.5 ng/ml (B asal) o amb S100A7 a 3 μM. A) Esquema de les membranes de RayBio®
C-Series Human Angiogenesis Array 1000. B) Expressió diferencial del sobrenedant en
les condicions de cultiu indicades. C) Densitat relativa per a cada citoquina obtinguda en
dividir la intensitat en píxels en presència de S100A7 entre la intensitat en píxels en el
medi basal. Els controls positius (POS) es van utilitzar per normalitzar. En alguns casos
no es va detectar s enyal (ND). El gràfic mostra la mitjana ± SEM. Test U de MannWhitney ns p>0.05, *p<0.05.
133
*
Basal
S100A7
Figura 25. Canvi morfològic de la línia THP1 en resposta a S100A7.
Cèl·lules de la línia monocítica THP1 es van cultivar en presència o absència de S100A7
(3 μM) durant 48 hores. Les fletxes indiquen les cèl·lules adherides (fenotip semblant als
macròfags).
A continuació, es va determinar l’efecte de la S100A7 sobre la secreció de citoquines a
la línia de fibroblast humà BJ utilitzant el mateix sistema. Com es pot veure a la Figura 26,
aquesta línia cel·lular secreta un nombre relativament baix de factors, de manera que només
va ser possible quantificar 16 de les 43 citoquines presents a l’array. D’aquestes 16, 5 no
van variar de manera significativa amb l’estímul de S100A7 (TIMP-2, GRO, ENA-78, TIMP-1
i IL-6). A més, tot i que algunes van mostrar un augment significatiu, la variació no va ser tan
elevada com en el cas de la THP1. En concret, el VEGF, el PLGF i el GM-CSF van ser els
que van presentar un major augment en resposta a S100A7 (2.17, 2.01 i 1.99 vegades
respectivament). Cal destacar que un dels factors que va mostrar un major augment en
aquesta línia cel·lular (el GM-CSF) coincideix amb la cèl·lula tumoral A431. A més, el VEGF
també es veia incrementat en la línia THP1.
Per últim, vam estudiar l’efecte de la proteïna S100A7 sobre les cèl·lules endotelials
HUVEC (Figura 27). En aquest cas, i a diferència del fibroblast, la línia endotelial va secretar
una gran varietat de citoquines, ja a nivell basal. Com en el cas de la línia THP1, alguns
factors van mostrar un gran augment en resposta a la S100A7, com per exemple el GM-CSF
(per sobre de 30 vegades), el MCP-3 (8.96 vegades) i la IL-6 (7.69 vegades). Altres, en
canvi, van mostrar un increment menor (EGF, VEGF, I-TAC, VEGFR2 i 3, etc.) o bé no es
van veure afectades significativament (per exemple IL-2, TIMP-2, THPO, endostatina, etc.).
A més, cal destacar en aquesta línia cel·lular l’augment de l’expressió de VEGF i els seus
receptors, la qual cosa donaria suport al paper proangiogènic de la proteïna S100A7.
134
Resultats
A
B
Human Angiogenesis Antibody Array C1
B
C
D
E
F
G
H
POS
NEG
NEG
ANG
EGF
ENA-78
bFGF
2
POS
POS
NEG
NEG
ANG
EGF
ENA-78
bFGF
3
GRO
IFNγ
IGF-1
IL-6
IL-8
Leptin
MCP-1 PDGF-BB
4
GRO
IFNγ
IGF-1
IL-6
IL-8
Leptin
MCP-1 PDGF-BB
5
PLGF
RANTES
TGFβ1
TIMP-1
TIMP-2
THPO
VEGF
VEGF-D
6
PLGF
RANTES
TGFβ1
TIMP-1
TIMP-2
THPO
VEGF
VEGF-D
7
B LA NK
B LA NK
B LA NK
B LA NK
B LA NK
B LA NK
NEG
POS
8
B LA NK
B LA NK
B LA NK
B LA NK
B LA NK
B LA NK
NEG
POS
Basal
2
A
B
C
D
G
H
POS
POS
NEG
NEG
ANGPT1 ANGPT2
E
F
PLG
Endostatin
POS
POS
ANGPT1 ANGPT2
PLG
Endostatin
NEG
NEG
3
G-CSF GM-CSF
I-309
IL-10
IL-1 α
IL-1 β
IL-2
IL-4
4
G-CSF GM-CSF
I-309
IL-10
IL-1 α
IL-1 β
IL-2
IL-4
5
I-TAC
MCP-3
MCP-4
MMP-1
MMP-9 PECAM-1
TIE-2
TNFα
6
I-TAC
MCP-3
MCP-4
MMP-1
MMP-9 PECAM-1
TIE-2
TNFα
7
uPAR
VEGFR2 VEGFR3
B LA NK
B LA NK
B LA NK
B LA NK
POS
8
uPAR
VEGFR2 VEGFR3
B LA NK
B LA NK
B LA NK
B LA NK
POS
C
VEGF
PLGF
ANG
RANTES
IL-8
MCP-1
IL-6
TIMP-1
ENA-78
GRO
TIMP-2
VEGF-D
THPO
TGFbea1
PDGF-BB
Leptin
IGF-1
IFNgamma
bFGF
EGF
Promig
2,174
2,008
1,393
*
*
*
*ns
1,257
1,211
1,157
1,142
ns
ns
ns
ns
1,113
1,083
1,061
0,894
-
ND
ND
ND
ND
ND
ND
ND
ND
ND
-
0.0
0.5
1.0
1.5
Membrana C2
Human Angiogenesis Antibody Array C2
1
Promig
GM-CSF
Endostatin
uPAR
MMP-1
MCP-3
VEGFR3
VEGFR2
TNFalpha
TIE-2
PECAM-1
MMP-9
MCP-4
I-TAC
IL-4
IL-2
IL-1 beta
IL-1 alpha
IL-10
I-309
G-CSF
PLG
ANGPT2
Membrana C1
ANGPT1
*
*
2.0
2.5
S100A7
Membrana C1
A
POS
1
3.0
1,993
1,394
1,392
1,260
*
*
1,217
-
ND
ND
ND
ND
ND
ND
ND
ND
ND
ND
ND
ND
ND
ND
ND
ND
ND
ND
-
0.0
0.5
*
*
*
Membrana C2
1.0
1.5
2.0
Densitat relativa
Densitat relativa
(increment front el Basal)
(increment front el Basal)
Figura 26. Anàlisi per array de le s citoquine s secretades per la línia fibroblàstica
BJ en presència de S100A7.
El sobrenedant de les cèl·lules B J es va analitzar a les 48 hores d’est ímul amb LPS a
13.5 ng/ml (B asal) o amb S100A7 a 3 μM. A) Esquema de les membranes de RayBio®
C-Series Human Angiogenesis Array 1000. B) Expressió diferencial del sobrenedant en
les condicions de cultiu indicades. C) Densitat relativa per a cada citoquina obtinguda en
dividir la intensitat en píxels en presència de S100A7 entre la intensitat en píxels en el
medi basal. Els controls positius (POS) es van utilitzar per normalitzar. En alguns casos
no es va detectar s enyal (ND). El gràfic mostra la mitjana ± SEM. Test U de MannWhitney ns p>0.05, *p<0.05.
135
2.5
A
B
Human Angiogenesis Antibody Array C1
B
C
D
E
F
G
H
POS
NEG
NEG
ANG
EGF
ENA-78
bFGF
2
POS
POS
NEG
NEG
ANG
EGF
ENA-78
bFGF
3
GRO
IFNγ
IGF-1
IL-6
IL-8
Leptin
MCP-1 PDGF-BB
4
GRO
IFNγ
IGF-1
IL-6
IL-8
Leptin
MCP-1 PDGF-BB
5
PLGF
RANTES
TGFβ1
TIMP-1
TIMP-2
THPO
VEGF
VEGF-D
6
PLGF
RANTES
TGFβ1
TIMP-1
TIMP-2
THPO
VEGF
VEGF-D
7
B LA NK
B LA NK
B LA NK
B LA NK
B LA NK
B LA NK
NEG
POS
8
B LA NK
B LA NK
B LA NK
B LA NK
B LA NK
B LA NK
NEG
POS
Basal
2
A
B
C
D
G
H
POS
POS
NEG
NEG
ANGPT1 ANGPT2
E
F
PLG
Endostatin
POS
POS
ANGPT1 ANGPT2
NEG
NEG
PLG
Endostatin
3
G-CSF GM-CSF
I-309
IL-10
IL-1 α
IL-1 β
IL-2
IL-4
4
G-CSF GM-CSF
I-309
IL-10
IL-1 α
IL-1 β
IL-2
IL-4
5
I-TAC
MCP-3
MCP-4
MMP-1
MMP-9 PECAM-1
TIE-2
TNFα
6
I-TAC
MCP-3
MCP-4
MMP-1
MMP-9 PECAM-1
TIE-2
TNFα
7
uPAR
VEGFR2 VEGFR3
B LA NK
B LA NK
B LA NK
B LA NK
POS
8
uPAR
VEGFR2 VEGFR3
B LA NK
B LA NK
B LA NK
B LA NK
POS
C
IL-6
ENA-78
EGF
VEGF
PDGF-BB
bFGF
IFNgamma
PLGF
Leptin
RANTES
IL-8
TGF-b
VEGF-D
GRO
ANG
MCP-1
IGF-1
TIMP-1
THPO
TIMP-2
Membrana C2
Human Angiogenesis Antibody Array C2
1
Promig
Promig
7,699
3,116
1,747
1,692
1,377
1,333
*ns
1,314
ns
1,266
*
*
*
*
*
1,738
*
*
ns
ns
1,250
1,210
1,130
ns
ns
ns
ns
ns
ns
ns
ns
1,107
1,105
1,080
1,040
1,011
0,943
0,924
0,922
0
1
Membrana C1
2
3
4 4
S100A7
Membrana C1
A
POS
1
GM-CSF
MCP-3
I-TAC
VEGFR3
VEGFR2
MCP-4
MMP-9
IL-1 beta
TNFalpha
MMP-1
ANGPT1
uPAR
ANGPT2
IL-1 alpha
TIE-2
IL-4
PLG
PECAM-1
Endostatin
IL-2
IL-10
I-309
G-CSF
9
30,336
8,960
2,434
*
*
*
*
*
*
*
*
*
*
*
*
*
ns
2,374
2,010
1,603
1,582
1,378
1,352
1,349
1,289
1,275
1,209
1,202
1,195
ns
ns
ns
ns
ns
1,177
1,011
1,008
0,974
0,969
ND
ND
ND
-
0
2
Membrana C2
4
6
8
10 10 40
Densitat relativa
Densitat relativa
(increment front el Basal)
(increment front el Basal)
Figura 27. Anàlisi per array de les citoquine s secretades per la línia endotelial
HUV EC en presència de S100A7.
El sobrenedant de les cèl·lules HUVE C es va analitzar a les 48 hores d’estímul amb LPS
a 13.5 ng/ml (Bas al) o amb S100A 7 a 3 μM. A) Esquema de les membranes de RayBio®
C-Series Human Angiogenesis Array 1000. B) Expressió diferencial del sobrenedant en
les condicions de cultiu indicades. C) Densitat relativa per a cada citoquina obtinguda en
dividir la intensitat en píxels en presència de S100A7 entre la intensitat en píxels en el
medi basal. Els controls positius (POS) es van utilitzar per normalitzar. En alguns casos
no es va detectar s enyal (ND). El gràfic mostra la mitjana ± SEM. Test U de MannWhitney ns p>0.05, *p<0.05.
136
*
Resultats
Amb tot, podem concloure que la proteïna S100A7 secretada al microentorn tumoral té
un efecte important sobre els diferents tipus cel·lulars que el componen, no només induint
una major capacitat de moviment, sinó també activant la secreció de determinats factors que
participen en processos com l’angiogènesi i la inflamació local i que contribueixen, en darrer
terme, al paper protumoral de la proteïna. Els resultats obtinguts demostren la gran
complexitat de la resposta induïda per la S100A7, que, a més, pot variar en funció de tipus
cel·lular. Aquests factors secretats, junt amb la pròpia proteïna S100A7, definiran, en part, el
seu paper en l’evolució de la malaltia.
4.6.5.2.
Estudi de la secreció del GM-CSF
Entre les citoquines analitzades a l’array, va destacar el GM-CSF, que es veu
augmentat en 3 dels 4 tipus cel·lulars (en la THP1 no es secreta en cap de les dues
condicions). Per això, vam decidir escollir-lo per tal de confirmar els resultats obtinguts
mitjançant una altra tècnica i estudiar la via a través de la qual es dóna aquesta secreció.
Després d’estimular les cèl·lules amb S100A7 o LPS tal com s’ha explicat a l’apartat
anterior, es van analitzar els sobrenedats utilitzant un kit de sandwich ELISA per quantificar
la presència del factor GM-CSF. Com es mostra a la Figura 28, la quantificació realitzada va
confirmar que la proteïna S100A7 indueix un increment en la secreció de GM-CSF per part
de la cèl·lula tumoral A431, la cèl·lula fibroblàstica BJ i la cèl·lula endotelial HUVEC, mentre
que la línia monocítica THP1 no secreta la proteïna a nivells detectables. A més, l’increment
observat en les tres línies va ser molt similar a l’obtingut en la quantificació dels resultats de
l’array.
A431
THP1
BJ
*
600
GM-CSF (pg/ml)
HUVEC
500
**
400
*
300
200
100
ns
0
-100
S100A7 (μM):
0
3
0
3
0
3
0
3
Increment:
-
4.42
-
1
-
1.39
-
380
Figura 28. Quantificació del GM-CSF secretat en resposta a S100A7 en diferents
línies cel·lulars.
Cèl·lules de les línies indicades es van c ultivar durant 48 hores en presència o en
absència de S100A7 (3 μM). El sobrenedant es va analitzar utilitzat un sandwich ELISA
137
per GM-CSF. El gràfic mostra la mitjana ± SEM. Test U de Mann-Whitney ns p>0.05,
*p<0.05, **p<0.01.
Degut al canvi tan important que s’observava en la línia cel·lular HUVEC i a que en
aquesta línia s’havia obtingut una gran reactivitat a la proteïna en diferents processos
cel·lulars (migració i adhesió), vam decidir escollir-la per estudiar en més profunditat la via
de senyalització activada en resposta a S100A7 i implicada en la secreció de GM-CSF.
Les cèl·lules es van estimular amb la proteïna en presència dels inhibidors de la
fosforilació de les principals quinases activades en resposta a altres membres de la família
de les S100 (p38, ERK1/2, JNK/SAPK i Akt) i del factor de transcripció NFκB. Després de 48
hores, es va analitzar per ELISA la secreció de GM-CSF al sobrenedant. Com es pot
observar a la Figura 29, els inhibidors de la fosforilació de p38 i JNK/SAPK i l’inhibidor de
l’activació de NFκB van bloquejar completament la secreció de GM-CSF en resposta a
l’estímul amb S100A7. En canvi, l’inhibidor de la fosforilació d’ERK1/2 va augmentar
lleugerament l’efecte de la proteïna, mentre que el d’Akt i l’inhibidor inespecífic (C-) la van
reduir parcialment. El motiu d’aquestes variacions pot ser degut a que la presència de
l’inhibidor afecta la viabilitat de les cèl·lules, afectant directament la secreció de citoquines.
GM-CSF (pg/ml)
600
500
400
300
200
100
0
-100
S100A7 (μM):
0
3
Inhibidor:
--
--
3
3
3
3
3
3
p38 ERK JNK Akt NFkB C-
Figura 29. Efecte dels inhibidors de vie s sobre la secreció de GM -CSF en re sposta
a l’estímul amb S100A7.
Cèl·lules de la línia endotelial HUVEC es van cultivar durant 48 hores en presència o en
absència de S100A 7 (3 μM) amb els inhibidors indicats a 1 μM (Akt) o a 20 μM (la resta).
La quantificació del GM -CSF secretat al sobrenedant es va realitzar per ELISA. El gràfic
mostra la mitjana ± SEM.
En aquest punt, és important remarcar que es va realitzar un estudi de viabilitat a les
48 hores d’incubació amb els inhibidors de vies, en les mateixes condicions d’assaig. Com a
resultat, es va veure que tots els inhibidors tenien un lleuger efecte tòxic sobre les cèl·lules,
138
Resultats
excepte el de p38, que augmentava la viabilitat. A més, l’inhibidor de NFκB era el que induïa
una major mortalitat. Per tant, per confirmar que les vies de senyalització implicades en la
resposta a S100A7 eren JNK/SAPK i p38, i que no es tractava d’un efecte indirecte, es va
realitzar una anàlisi per western blot de la fosforilació d’aquestes quinases a temps curts
d’estímul (10, 30 i 60 minuts) i amb la mateixa dosi de proteïna. A més, es va utilitzar
l’estímul amb VEGF durant 30 minuts com a control positiu ja que s’ha vist que pot induir la
fosforilació de les 3 quinases en aquesta mateixa línia cel·lular (Shen et al., 2012).
Temps (min):
0
10
30
60
30
S100A7 (μM):
0
0
3
0
3
0
3
0
VEGF (ng/ml):
0
0
0
0
0
0
0
10
42 kDa -
Phospho-p44/42
(ERK1/2)
42 kDa -
p44/42 (ERK1/2)
Densitometria ph-ERK/ERK:
--
100 135
100
116
100
84
193
Phospho-p54/46
(SAPK/JNK)
54 kDa 46 kDa 54 kDa -
p54/46 (SAPK/JNK)
46 kDa -
Densitometria ph-p54/p54:
--
100
310 100
110
100
53
159
Densitometria ph-p46/p46:
--
100
237 100
132
100
33
129
Phospho-p38
38 kDa -
p38
38 kDa -
Densitometria ph-p38/p38:
--
100
84
100
59
100
64
53
β-actina
42 kDa -
Figura 30. Estudi de la via de senyalització activada per S100A7 en HUVEC.
Les cèl·lules HUVE C es van estimular amb o sense S100A7 durant els temps indicats i
es va analitzar l’activació de les diferents vies per western blot. L’anàlisi densitomèt ric es
va realitzar des prés de normalitzar la densitat de cada banda de proteïna fos forilada,
respecte de la proteïna total. Es va considerar com a 100%, la densitat obtinguda en
absència de S100A7 per a cada temps.
Com es mostra a la Figura 30, la proteïna S100A7 indueix la fosforilació d’ERK1/2 i
JNK/SAPK, amb un pic molt clar als 10 minuts, però no de p38, en les condicions assajades.
En relació amb els resultats obtinguts en l’anàlisi per sandwich ELISA, es confirmaria
l’activació de la via de JNK/SAPK per part de la S100A7, i que aquesta via està involucrada
139
en l’expressió de GM-CSF en la cèl·lula endotelial HUVEC. A més, s’observa que la S100A7
pot induir la fosforilació d’ERK1/2, tot i que aquesta via sembla no estar implicada en
l’expressió de GM-CSF. D’altra banda, serien necessaris estudi més amplis per aclarir les
controvèrsies al voltant de la via de p38, ja que la seva inhibició bloqueja completament
l’efecte de la S100A7 a nivell de secreció de GM-CSF, però no hem pogut observar
l’activació de la via per western blot en les condicions utilitzades, ni tan sols amb el VEGF. A
més, l’activació de p38 en HUVEC ha estat relacionada amb un augment de la migració
cel·lular i un descens de la proliferació (McMullen et al., 2005), la qual cosa també
concordaria amb els resultats obtinguts en aquest treball.
4.6.5.3.
Estudi de la secreció de la MMP9
Correlacionant amb el paper promigratori de la proteïna S100A7, hem observat, en
algunes de les línies estudiades, un augment de la secreció de metal·loproteïnases de la
matriu, com la MMP9, i fins i tot, en el cas de la THP1, un descens en l’expressió d’un dels
seus reguladors negatius, com són els TIMPs. De fet, està descrit que el balanç entre les
MMP i els TIMP és determinant per al grau de proteòlisi del microambient tumoral i que la
pertorbació d’aquest equilibri en el càncer pot ser un factor clau en la progressió dels tumors
cap a fenotips més malignes (Brew and Nagase, 2010; Kessenbrock et al., 2010). Com s’ha
explicat a la introducció, les formes realment actives de les MMP, i que, per tant, tenen
importància biològica, són el resultat de la proteòlisi dels zimògens o pro-MMP secretats per
les cèl·lules.
Dels resultats obtinguts en els arrays, hem observat un increment de MMP9 total en
les línies HUVEC, THP1 i A431, en resposta a l’estímul amb S100A7. Per estudiar si la
S100A7 induïa no solament secreció de MMP totals sinó també una major activitat d’aquests
enzims, es van realitzar anàlisis de zimografia en gelatina.
A la Figura 31A es mostra l’anàlisi realitzat a les 48 hores d’estímul de la línia
endotelial HUVEC amb diferents dosis de S100A7, on es veu un augment de la forma proMMP9 (2.7 vegades a la màxima dosi) i sobretot l’aparició de bandes corresponents a la
MMP9 activa (increment de 4.6 vegades a 3 μM de S100A7), mentre que la MMP2 no es va
veure afectada.
Aprofitant aquest resultat, vam voler comprovar si a nivell de secreció de
metal·loproteïnases s’observava el mateix efecte que en migració, on la combinació de
S100A7 amb VEGF donava com a resultat la suma dels efectes dels dos factors per separat.
Amb aquest propòsit, es va combinar la proteïna S100A7 a la dosi on es va observar el
major efecte (3 μM) amb VEGF a 10 ng/ml. En aquest cas, el VEGF va tenir un efecte molt
140
Resultats
petit sobre la secreció de formes actives de la MMP9 (tan sols 1.15 vegades). La combinació
dels dos factors va donar un resultat lleugerament superior a la suma dels efectes per
separat, segons la quantificació de la densitat de les bandes de la forma activa de la MMP9,
però sense arribar a un efecte clarament sinèrgic, la qual cosa confirmaria l’efecte additiu
dels dos factors (Figura 31B).
Per últim, vam voler veure si la via de senyalització implicada en la secreció de la
MMP9 en resposta a S100A7 era la mateixa que per al GM-CSF. Per això, vam incubar les
cèl·lules amb la proteïna en presència dels inhibidors de vies i es va analitzar el sobrenedant
a les 48 hores. Tot i que la imatge no és molt nítida, es pot observar com l’efecte inductor de
la S100A7 es veu inhibit sobretot pel bloqueig de JNK/SAPK i de NFκB (Figura 31C). En el
cas de l’inhibidor de NFκB, la secreció de proteïnes torna a ser molt baixa, a causa de
l’elevada mortalitat induïda per aquesta molècula química. Tenint en compte això i els
resultats explicats anteriorment, podem considerar que l’inhibidor de la fosforilació de
JNK/SAPK està inhibint de manera específica la secreció de pro-MMP9 i MMP9 activa
induïda per la S100A7, ja que altres inhibidors amb un efecte tòxic similar sobre la viabilitat
cel·lular, com és el cas d’ERK1/2, no tenen el mateix efecte a nivell de MMP. Per tant,
considerant aquests resultats i els de l’apartat anterior, podem confirmar que la via de
JNK/SAPK es troba implicada en la resposta a l’estímul amb S100A7 en la cèl·lula
endotelial.
A
S100A7 (μM):
0
0.3
1
3
pro-MMP9
MMP9 activa
pro-MMP2
92 kDa 72 kDa Densitometria:
Densitometria:
B
S100A7 (μM):
VEGF (ng/ml):
102
98
0
0
3
0
200
139
276
465
0
10
3
10
-- pro-MMP9
-- MMP9 activa
92 kDa -
pro-MMP9
MMP9 activa
72 kDa -
pro-MMP2
Densitometria:
Densitometria:
100
100
100
100
152
376
106
115
141
158
429
-- pro-MMP9
-- MMP9 activa
C
S100A7 (μM):
Inhibidor:
0
--
3
--
3
3
JNK ERK
3
p38
3
3
3
Akt NFκB C-
92 kDa -
pro-MMP9
MMP9 activa
72 kDa -
pro-MMP2
Densitometria:
Densitometria:
100
0
518
100
184
0
489
96
615
86
395
84
0
0
518
56
-- pro-MMP9
-- MMP9 activa
Figura 31. Secreció i activitat de les metal·loproteïnases en re sposta a S100A7 en
la línia endotelial HUVEC.
El sobrenedant de les cèl·lules HUVE C es va analitzar per zimografia en gelatina a les
48 hores d’estímul. A) E fecte dosi-depenent a les concentracions indic ades de S100A 7.
B) E fecte de la combinació de S100A 7 i VEGF. C) E fecte dels inhibidors de vies sobre
l’efecte induït per S100A 7.
Aprofitant l’efecte observat en resposta a la proteïna, vam voler comprovar que els
anticossos monoclonals seleccionats eren capaços d’interferir en la resposta a S100A7, no
només inhibint l’efecte a nivell cel·lular (moviment), sinó també bloquejant la seva
senyalització i, per tant, la secreció dels factors regulats per ella, en aquest cas, la MMP9.
Per això, es va realitzar l’estímul de les cèl·lules endotelials amb la proteïna i en presència
dels sis anticossos monoclonals candidats i es va analitzar el sobrenedant per zimografia a
les 48 hores. Com es pot observar a la Figura 32, els anticossos contra la proteïna van
reduir la secreció de MMP9 i sobretot de les seves formes actives, mostrant tots ells una
eficàcia similar.
S100A7 (μM):
mAb (9 μM):
3
--
3
2D9
3
3
2H3 6E3
3
3
6F5 8B6
3
9F3
92 kDa -
pro-MMP9
MMP9 activa
72 kDa -
pro-MMP2
Densitometria:
Densitometria:
100
100
75
18
89
21
92
25
84
21
65
13
69
16
-- pro-MMP9
-- MMP9 activa
Figura 32. Bloqueig de la resposta induïda per S100A7 amb els anticossos
monoclonals.
Després de 48 hores d’estímul en les condicions indicades, el sobrenedant de les
cèl·lules endotelials HUVE C es va analitzar per zimografia en gelatina.
142
Resultats
D’altra banda, en l’anàlisi realitzat mitjançant l’array de citoquines, la línia cel·lular que
mostrava un major increment de secreció de MMP9 en resposta a S100A7 era la THP1.
Igual que vam fer per la cèl·lula endotelial, es van realitzar anàlisis de zimografia en gelatina
per estudiar si aquesta variació implicava també una major secreció de formes actives. A
més, es va testar l’efecte dels inhibidors de vies en les mateixes condicions que en la
cèl·lula endotelial, per veure si era similar a l’observat en aquesta línia. Com es mostra a la
Figura 33, la S100A7 indueix un augment clar de la secreció de la pro-MMP9, però, a
diferència de la cèl·lula endotelial, no s’observa un augment de les formes actives d’aquest
enzim. A més, l’inhibidor de JNK/SAPK torna a ser el que afecta en major mesura la
resposta a S100A7, bloquejant la secreció de pro-MMP9, la qual cosa confirma JNK com
una de les quinases clau en la seva via de senyalització. En aquest cas, a més, l’inhibidor
d’ERK1/2 també té un efecte important, confirmant que la S100A7 també activa la via
d’ERK1/2, com s’ha pogut veure en l’anàlisi a temps curts realitzats en la línia endotelial
HUVEC. Per últim, l’inhibidor de NFκB té un efecte tòxic sobre la cèl·lula, per la qual cosa no
s’observa secreció de MMP9 ni de MMP2.
Inhibidor:
S100A7 (3 μM):
--
-
JNK
+
-
+
ERK
-
+
p38
-
Akt
+
-
NFκB
+
-
+
C-
-
+
92 kDa -
pro-MMP9
72 kDa -
pro-MMP2
Densitometria: 100
673 100 137 100 386 100 702
100 734
--
--
100 767 -- pro-MMP9
Figura 33. Secreció de les metal·loproteïnase s en re sposta a S100A7 en la línia
THP1.
El sobrenedant de les cèl·lules THP 1 es va analitzar per zimografia en gelatina a les 48
hores d’estímul en les condicions indicades.
Cal tenir en compte que la línia cel·lular THP1 no expressa el receptor RAGE, mentre
que la cèl·lula endotelial HUVEC si, per la qual cosa seria probable que la S100A7 estigués
induint en darrer terme un efecte similar en ambdues línies utilitzant receptors diferents , però
activant vies de senyalització similars.
143
4.7. Regulació de l’expressió de S100A7 in vitro en la línia A431
En l’estudi de l’expressió de la S100A7 en la línia cel·lular de carcinoma epidermoide
A431 es va observar que, mentre que en condicions normals de cultiu no expressa la
proteïna, quan és implantada subcutàniament en ratolins comença a expressar alts nivells
(vegeu la Taula 4). Tenint en compte aquest resultat, vam voler estudiar la regulació de la
seva expressió simulant condicions que es donen al microambient tumoral com són la falta
d’oxigen, la manca de nutrients, una elevada densitat cel·lular o l’exposició a factors de
creixement secretats per la pròpia cèl·lula tumoral o per altres components de l’estroma.
La línia cel·lular A431 es va sembrar en plaques de 6 pous i medi complet i, a les 24
hores, es va sotmetre a diferents condicions de cultiu. L’expressió i la secreció de S100A7 al
llarg del temps es va determinar per western blot i per sandwich ELISA, respectivament.
D’una banda, per simular un ambient hipòxic, les cèl·lules es van exposar a 200 μM de
CoCl2, un metall de transició que bloqueja l’enzim prolil hidroxilasa (HIF-PH) evitant així la
hidroxilació i conseqüent degradació del factor de transcripció HIF-1α (Zhou et al., 2004). A
cada temps (de 2 a 144 hores), es va recollir un pou control i un pou exposat al metall. A la
Figura 34A es veu com l’exposició a CoCl2 indueix l’activació de HIF-1α a les 2 hores
d’estímul, si ho comparem amb el control al mateix temps. Aquest augment de HIF-1α és
encara més visible a les 6 hores i va disminuint a les 24, 48 i 72 hores, quan ja no es pot
detectar. A més, veiem que en les cèl·lules exposades a CoCl 2 es comença a expressar la
proteïna S100A7 a partir de les 72 hores tot i que en molt petita quantitat.
Temps (h):
CoCl2 (200 μM):
2
-
6
+
-
24
+
-
+
48
-
72
+
-
144
+
-
+
A7rh
A
β-actina
42 kDa -
HIF-1α
93 kDa -
S100A7
B
Temps (d):
A7rh
13 kDa -
0
2
4
6
8
10
12
42 kDa -
β-actina
13 kDa -
S100A7
144
Resultats
C
0
A7rh
Temps (d):
CM:
-
6
-
THP NIH
12
-
THP NIH
42 kDa -
β-actina
13 kDa -
S100A7
D
E
Citoquina:
2
-
TNFα TGFβ
6
-
TNFα TGFβ
42 kDa -
β-actina
13 kDa -
S100A7
S100A7 (ng/ml)
Temps (d):
6 dies
2 dies
60
*
50
40
30
20
*
10
ns
ns
TG
Fb
-
Fa
TN
Fa
TG
Fb
TN
-
0
Figura 34. Estudi de l’expressió de S100A7 in vitro en la línia A431.
A) Western blot de HIF-1α i S100A7 en cèl·lules exposades a CoCl2 (200 μM) o sense
estimular. B) Western blot de S100A7 en cèl·lules deprivades de nutrients. C) Western
blot de S100A7 en cèl·lules estimulades amb el medi condicionat de THP1 (THP) o
NIH3T3 (NIH). D) Western blot de S100A7 en cèl·lules estimulades amb 100 ng/ml de
TNFα o TGFβ. E) S100A 7 secretada al medi en resposta a l'estímul de 100 ng/ml de
TNFα o TGFβ durant el temps indicat. El gràfic mostra la mitja na ± SEM. Test U de
Mann-Whitney ns p>0.05, *p<0.05.
D’altra banda, es van cultivar les cèl·lules en medi sol, per tal de veure l’efecte de la
deprivació de nutrients sobre l’expressió de la S100A7 al llarg del temps. Es van recollir
cèl·lules cada 2 dies fins a dia 12, sent impossible allargar l’experiment degut a que les
cèl·lules morien per la falta de suplements en el medi. En aquest cas, no es va observar
expressió de S100A7 en cap moment, tal com mostra l’anàlisi per western blot (Figura 34B).
Dins el tumor, les cèl·lules malignes es troben exposades a multitud de factors
secretats per elles mateixes o per altres cèl·lules estromals que poden fer variar l’expressió
d’altres proteïnes (Karagiannis et al., 2012). En aquest sentit, està descrit que determinats
factors com la oncostatina-M o la IL-6 poden induir l’expressió de S100A7 en determinades
condicions (West and Watson, 2010). En relació a aquestes dades, vam voler veure si la
línia A431 començava a expressar la proteïna S100A7 en resposta a factors provinents
d’altres tipus cel·lulars. Les cèl·lules es van exposar durant diferents temps a medis
condicionats obtinguts a partir de la línia fibroblàstica NIH3T3 i de la línia monocítica THP1 i
a continuació es va analitzar l’expressió de S100A7 per western blot. Com es veu a la
145
Figura 34C, cap dels dos medis condicionats va ser capaç d’induir l’expressió de S100A7
després de 12 dies d'exposició.
Donat que als medis condicionats utilitzats hi havia una barreja complexa i
desconeguda de factors, vam voler estudiar de manera més concreta l’efecte de les
citoquines TNFα i TGFβ per tal de tenir un sistema més controlat on la concentració de
proteïna afegida fos coneguda. Per això, es van exposar les cèl·lules a 100 ng/ml de TNFα o
TGFβ en medi complet, a més d’incloure un control sense estimular per a cada temps. Es va
estudiar l'expressió de S100A7 per western blot als 2 i als 6 dies d'estímul. Com es veu a la
Figura 34D, el TNFα indueix l’expressió de la S100A7 mentre que el TGFβ no ho fa. A més,
vam estudiar si la proteïna era secretada per la cèl·lula utilitzant el sandwich ELISA
desenvolupat al laboratori i vam determinar que la A431 secreta nivells detectables de
S100A7 al sobrenedant (fins a 50 ng/ml als 6 dies) en resposta a TNFα (Figura 34E). Un
estudi anterior publicat per Hau i altres (Hau et al., 2013), va mostrar que el TNFα podia
induir l’expressió de S100A7 a concentracions d’entre 0.1 i 100 ng/ml sobre queratinòcits
humans. Segons aquest estudi, l’expressió era induïda per l’activació del factor de
transcripció NFκB. Estudis més profunds serien necessaris per determinar si, en el nostre
model experimental, l’activació de l’expressió de S100A7 en resposta a TNFα es dóna per la
mateixa via.
Per últim,està descrit que les cèl·lules d’epiteli mamari no tumorals MCF10A,
comencen a expressar elevats nivells de S100A7 quan es troben sota condicions d’elevada
confluència (Enerback et al., 2002). Per determinar si l'elevada densitat cel·lular que es dóna
a nivell tumoral afectava l'expressió de la proteïna en la línia A431, es van cultivar les
cèl·lules fins a una confluència del 100% en medi complet i es van mantenir en aquestes
condicions durant 36 dies, recollint el sobrenedant i les cèl·lules d'un pou cada 3-4 dies. Per
evitar la mort per falta de nutrients, es va canviar el sobrenedant de tots els pous cada 3-4
dies. A més, el sobrenedant del pou a recollir es va substituir per medi fresc 24 hores abans
de la seva recollida per tal d’evitar la presència de S100A7 degut a la lisi cel·lular. Com es
mostra a la Figura 35A, el cultiu en condicions d'elevada confluència indueix una gran
expressió de la proteïna. Aquesta expressió és ja visible a dia 12 i va augmentant al llarg del
temps. A més, l’anàlisi del sobrenedant d’aquestes cèl·lules, va mostrar una presència cada
cop més elevada de S100A7 al medi (Figura 35B), arribant a 200 ng/ml a dia 36 i
correlacionant amb els nivells d’expressió observats per western blot. En comparació amb
els resultats obtinguts amb l'estímul de TNFα, la hiperconfluència indueix una major
expressió de S100A7, tot i que triga més dies a poder ser detectada.
146
Resultats
Veient aquests resultats, vam voler comprovar si l’expressió era homogènia dins el
cultiu. Per això, vam utilitzar l’anticòs anti-S100A7 9F3 per fer una tinció d'immunocitoquímica de les cèl·lules als 23 dies de confluència. Abans de fer la tinció, es va comprovar
per ELISA que les cèl·lules secretaven S100A7 al sobrenedant. Com es veu a la Figura
35C, no totes les cèl·lules del cultiu tenen marcatge de S100A7 sinó que l'expressió sembla
estar limitada a aquelles cèl·lules que es troben en els cúmuls amb més densitat cel·lular.
En paral·lel, es va fer una tinció de la línia A431 a les 24 hores de ser sembrades, on no es
va observar presència de S100A7 (cèl·lules a temps 0).
A continuació, vam voler determinar si, un cop les cèl·lules començaven a expressar la
proteïna, aquesta expressió era estable o bé es veia reduïda a mesura que es feien passis
en condicions normals de cultiu. Per això, es va desenganxar amb tripsina un dels pous que
portava 36 dies en elevada confluència i es va replaquejar en dos pous. La confluència
inicial dels dos pous va ser del 70%. Després d'una setmana, es va obtenir la proteïna i el
sobrenedant d'un dels pous com s'ha explicat anteriorment, i l'altre es va replaquejar. Aquest
procediment es va repetir 3 cops. Posteriorment, es va analitzar l'expressió de les cèl·lules a
diferents passis i la secreció de S100A7 al medi. Com es veu a la Figura 35D i 35E, les
cèl·lules perden l’expressió un cop deixen d'estar sotmeses a elevada confluència, la qual
cosa demostra que l’expressió d'aquesta proteïna en aquesta línia cel·lular no és estable i
està directament lligada a les condicions en què es troben.
Amb aquests resultats, s'ha demostrat que la línia tumoral A431 pot expressar la
proteïna S100A7 sota determinades condicions de cultiu, com l’activació de HIF-1α,
l’elevada confluència o en resposta a factors externs com el TNFα, fet que es pot relacionar
A
Temps (d):
A7rh
amb l’expressió observada durant el seu creixement in vivo.
0
5
8
12
15 19
22
26
36
β-actina
13 kDa -
S100A7
S100A7 secretada
(ng/ml)
42 kDa -
B
200
150
100
50
0
0
5
8
12
15
19
22
26
Dies en confluència
29 32
147
29
33
36
E
24
***
50
***
***
0
0
30
100
D
ia
43
150
36
Pa
ss
i1
Pa
ss
i2
Pa
ss
i3
S100A7
13 kDa -
200
D
ia
β-actina
***
S100A7 secretada
(ng/ml)
42 kDa -
Densitometria: 100
Confluents (23 dies)
Passi 3
Passi 1
Dia 36
D
Passi 2
Temps 0
C
Figura 35. Estudi de l’expressió de la S100A7 en la línia A431 hiperconfluent.
A) A nàlisi per western blot de l’expressió de S100A7 després dels dies indicats sota
condicions d’elevada confluència. B) A nàlisi per sandwich ELISA de la sec reció de
S100A7 per part de les cèl·lules de l’apartat A. C) A nàlisi per immunocitoquímica de la
línia A 431 a temps 0 o després de 23 dies en elevada confluència. En blau, nuclis
cel·lulars marcats amb Hoechst. En verd, S100A7 marcada amb l’anticòs 9F3. D) Anàlisi
per western blot de l’expressió de S100A7 en la línia A431 després de 36 dies en
confluència i ser replaquejada 3 cops (passis 1, 2 i 3). E) A nàlisi per sandwich E LISA de
la secreció de S 100A 7 per part de les cèl·lules de l’apartat D. Els gràfics mostren la
mitjana ± SEM. Test U de Mann-Whit ney ***p<0. 001.
4.8. Estudi d’eficàcia in vivo dels anticossos anti-S100A7
Un cop confirmada la implicació de la proteïna S100A7 a nivell extracel·lular sobre
diferents tipus cel·lulars (tumoral, endotelial, immune i fibroblasts) i havent demostrat
l’eficàcia del bloqueig de la seva funció amb els anticossos monoclonals específics en
diferents models in vitro, ens vam plantejar avaluar l’ús d’aquests anticossos com a agents
terapèutics en estudis in vivo de creixement tumoral.
Fins a aquest moment, hi havia poques dades sobre la implicació extracel·lular de la
S100A7 en el desenvolupament tumoral per se i els únics estudis descrits havien estat
148
Resultats
dirigits a establir una correlació entre la presència (cèl·lules transfectades que
sobreexpressen la proteïna) (Nasser et al., 2012) o absència (cèl·lules transfectades amb
shRNA) (Liu et al., 2013) de S100A7 i la progressió del tumor. Per tant, no existien dades
prèvies en relació a l’ús de productes químics o biològics que demostressin la proba de
principi per a tractaments antitumorals dirigits al bloqueig d’aquesta diana.
A l’hora d’escollir el model tumoral per validar els anticossos monoclonals
seleccionats, ens vam fixar en les característiques i resultats obtinguts per a la línia humana
de carcinoma epidermoide A431 que, encara que no expressa la proteïna en condicions de
cultiu normals, si que la sobreexpressa durant el creixement subcutani en ratolins atímics.
Abans de realitzar l’estudi d’eficàcia dels anticossos, va ser necessari caracteritzar el
creixement de la línia i l’expressió de la S100A7 in vivo per determinar quin seria el millor
moment per començar el tractament.
4.8.1. Caracterització del creixement subcutani de la línia tumoral A431
Per a la caracterització del creixement de la línia cel·lular in vivo es van inocular 4
milions de cèl·lules/animal de manera subcutània al costat dret de ratolins femella atímics i
es va seguir l'evolució del volum tumoral i del pes dels animals al llarg de tot l’experiment.
Per tal de determinar en quin moment es començava a expressar la proteïna S100A7, es
van obtenir tumors a diferents dies de creixement i diferents volums.
A la Figura 36A es mostra la corba de creixement d’aquells tumors que es van
mantenir fins a dia 52 (n = 7). El creixement de la A431 in vivo es caracteritza per una
primera etapa de latència, fins als 10 dies aproximadament, on l’evolució és molt lenta, i una
segona etapa amb un creixement exponencial. El temps de duplicació en aquesta primera
etapa va ser d’uns 20 dies, mentre que en la segona es va reduir a la meitat (9.5 dies). El
pes dels animals no es va veure afectat pel creixement dels tumors al llarg de l’experiment,
tal com mostra la Figura 36B.
Com es pot veure en l’anàlisi per western blot (Figura 37), mentre que la línia tumoral
A431 no expressa la S100A7 a nivell cel·lular (Membrana A, carril 2), a mesura que creix in
vivo comença a expressar grans quantitats de S100A7. Cal destacar que l’expressió sembla
anar en funció dels dies de creixement i no tant del volum ja que hi ha tumors petits que, en
portar més de 10 dies de creixement, ja expressen nivells molt elevats de la proteïna, com
es el cas del tumor de 78 mm 3 de la membrana A. Addicionalment, es va determinar
l’expressió d’un altre membre de la família, la S100A4, que ja es troba a nivells elevats in
vitro, i no es van observar variacions en funció del volum tumoral. Aquest fet confirma que
149
l’expressió de S100A7 es veu regulada sota determinades condicions i/o per factors externs
a la pròpia cèl·lula tumoral, mentre que en proteïnes que ja es troben des del moment inicial,
com la S100A4, aquests no són tan determinants. A més, el fet que la línia tumoral A431
comenci a expressar la proteïna a partir d'un moment determinat fa pensar que és important
pel desenvolupament del tumor. Per tant, el bloqueig de la S100A7 podria tenir un efecte
notable sobre la seva evolució.
B
35
1000
Pes corporal (g)
Volum tumoral (mm3)
A
800
600
400
200
33
30
28
25
23
20
0
0
10
20
30
40
50
0
60
10
20
30
40
50
60
Dies de creixement
Dies de creixement
Figura 36. Creixement subcutani de la línia tumoral A431.
A) Corba de creixement dels tumors de A431. La línia discontinua marca l’inici de la fase
exponencial de creixement. B) Pes dels animals al llarg de l’experiment. Les corbes
mostren la mitjana ± SEM.
943
740
195
97
10 10 10 35 52 52
66
3
49
3
33
848
502
172
Volum:
(mm3)
A7rh
Dia:
20 35 35 49
78
3
56
3
48
24
Volum:
(mm3)
3
In vitro
A7rh
Dia:
23
Membrana B
Membrana A
42 kDa –
β-actina
42 kDa –
β-actina
13 kDa –
S100A7
13 kDa –
S100A7
12 kDa –
S100A4
Membrana C
902
545
195
49
94
10 10 10 20 65 49
64
3
29
Volum:
(mm3)
A7rh
Dia:
978
828
239
99
10 20 35 52 65
77
3
50
3
34
A7rh
Volum:
(mm3)
24
3
Dia:
Membrana D
42 kDa –
β-actina
42 kDa –
β-actina
13 kDa –
S100A7
13 kDa –
S100A7
Figura 37. Expressió de la S100A7 en el model subcutani de la línia tumoral A431.
L'expressió de S100A7 en la línia cel·lular A431 i en els tumor subcutanis generats es va
analitzar per western blot en 4 tandes (membranes A a D).
150
Resultats
Tenint en compte aquests resultats i fixant-nos en la corba de creixement dels tumors
mostrada a la Figura 36, s'observa que en el moment en què els tumors començaven a
expressar una quantitat important de S100A7 sembla coincidir amb la reducció del temps de
duplicació observat, la qual cosa ens confirmaria que la S100A7 està participant directament
en el seu creixement.
A més de determinar l’expressió de la proteïna a nivell de western blot, ens vam
interessar per la seva distribució dins el teixit, per la qual cosa es va realitzar una tinció
d’immunohistoquímica utilitzant l’anticòs 2D9-biotinilat. La Figura 38A mostra el resultat de
la tinció d'hematoxilina/eosina i amb l’anti-S100A7 d’un dels tumors obtinguts.
A
S100A7
H/E
B
Figura 38. Anàli si de la distribució de S100A7 dins el tumor subcutani derivat de la
línia tumoral A431.
Talls de 5 μm de gruix del tumor parafinat de la línia A431 es van t enyir amb l’antiS100A7 o bé amb hematoxilina/ eosina (H/E) i es van prendre imatges a 100 augments.
A) Imatge del tumor sencer. B) Detall ampliat de la zona marcada a l’apartat A.
Si ens fixem en la tinció amb hematoxilina/eosina, es diferencia clarament la zona
necròtica al centre del tumor (rosa clar), del teixit viu de la perifèria (color marronòs). A la
zona necròtica, es va obtenir un senyal elevat en la tinció amb S100A7, degut en part a la
proteïna alliberada pel teixit mort. Dins el teixit viu, l’expressió de la proteïna va ser molt més
151
elevada en les zones que rodejaven la part necròtica i també en alguns cúmuls de cèl·lules,
com es pot observar a la imatge ampliada de la Figura 38B. Per tant, sembla que la A431 in
vivo, té una elevada expressió de S100A7 però no de manera homogènia en tot el teixit, sinó
que l’expressió sembla estar limitada a determinades zones. Aquest fet corrobora els
resultats obtinguts a l’apartat 4.7, on es va veure que la línia A431 també expressava la
proteïna S100A7 in vitro sota condicions de cultiu concretes i, a més, ho feia de manera
heterogènia dins el cultiu.
Alguns tumors tenen un percentatge elevat de cèl·lules estromals, en la seva majoria
fibroblasts. Un dels marcadors utilitzats per estudiar els fibroblast activats que es troben dins
el tumor és la proteïna αSMA (de l’anglès Alpha Smooth Muscle Actin) (Cherng et al., 2008).
Aquests miofibroblast tenen un paper determinant en la progressió tumoral, donant suport a
les cèl·lules canceroses i contribuint a l’èxit de la malaltia (Madar et al., 2013).
Per tal de confirmar que les cèl·lules dins els tumor que no presentaven tinció de
S100A7, eren cèl·lules tumorals i no miofibroblasts, es va realitzar una tinció
d'immunohistoquímica de fluorescència de la proteïna αSMA. A més, es va tenyir un tall del
mateix tumor amb l’anticòs 2D9-biotinilat per determinar la presència de S100A7. A la
Figura 39 es mostra el resultat de les dues tincions, on es pot observar la proporció
relativament baixa de fibroblasts infiltrats (marcats en color verd) dins el tumor (nuclis
marcats en color blau). A la imatge de la dreta es veu l'expressió de S100A7 en la mateixa
zona del teixit. Com es pot observar, les cèl·lules que no expressen la proteïna S100A7 no
són miofibroblasts, confirmant que dins el tumor hi ha cèl·lules de la línia A431 que no
expressen la proteïna, mentre que altres la expressen a uns nivells molt elevats.
Figura 39. Presència de fibroblasts dins el tumor de la línia A431.
Talls de 5 μm de gruix del tumor es van tenyir per immunohistoquímica utilitzant un antiαSMA (smooth muscle actin) i l'anti-S100A 7. A l’esquerra, el resultat de la tinció per
152
Resultats
fluorescència del αSMA (verd) i dels nuclis cel·lulars (blau). A la dreta, la presència de
S100A7 a la mateixa zona del teixit.
D’altra banda, vam voler veure si el fet de tenir un tumor que expressa la proteïna
permet detectar-la a la sang dels ratolins, la qual cosa indicaria que aquesta proteïna és
alliberada per les cèl·lules tumorals, tal com hem vist in vitro, i que, per tant, pot ser valorada
com a biomarcador. Amb aquest propòsit, es va recol·lectar el sèrum dels ratolins a punt
final i es va realitzar una quantificació utilitzant el sandwich ELISA desenvolupat. Tal com es
veu a la Figura 40A, existeix una correlació estadísticament significativa (p<0.0001) entre la
concentració de S100A7 en sang i el volum tumoral.
A
B
*** p<0.0001
r2 0.49
200
*
*
75
S100A7 (ng/ml)
150
100
50
50
25
0
0
250
500
750
1000
1250
tu
m
0
or
pr
eop
er
at
or
i
po
st
-o
pe
ra
to
ri
S100A7 (ng/ml)
250
se
ns
e
Volum tumoral (mm3)
Figura 40. Presència de S100A7 al sèrum de ratolins amb tumors subcutani s de
A431.
Quantificació per sandwich ELISA de la proteïna S100A7 present al sèrum dels animals
amb t umors subcutanis de la línia A431. A) Relació ent re la concentració de S100A7 en
sang i el volum tumoral. La recta mostra la mitjana ± 95% de l’interval de confiança.
B) S100A7 en sang de ratolins abans i després de ser operats per eliminar el tumor. El
gràfic mostra la mitjana ± SEM. Test U de Mann-Whitney *p<0.05.
Alguns biomarcadors tumorals son utilitzats per la detecció precoç de recidives un cop
el tumor ha estat extirpat i el pacient està aparentment curat. Per exemple, en el c àncer
colorectal s’utilitza la detecció plasmàtica del CEA (Antigen carcinoembriogènic) (Duffy,
2001). Aquest marcador va disminuint a mesura que el tractament fa ef ecte fins que acaba
desapareixent, i quan el CEA torna a aparèixer en sang, és símptoma de que el tumor està
recreixent. Simulant aquest fet, vam voler veure si els nivells de S100A7 en sang estaven
directament lligats a la presència o absència del tumor i com de ràpid aquesta proteïna
desapareixia quan s’eliminava la font d’origen (el tumor). Per això, es van seleccionar 3
ratolins amb volums tumorals de 740, 828 i 943 mm 3 i se’ls hi va extirpar el tumor. Just
153
abans de l'operació, es va extreure sang dels ratolins, per tal de tenir els nivells
preoperatoris de S100A7. A les 72 hores de l’operació, es van sacrificar els animals i es va
col·lectar el sèrum. L’anàlisi del nivell de S100A7 mostra que solament en presència de
tumor els ratolins tenen uns nivells detectables de proteïna en sèrum, mentre que en els
ratolins sense tumor no es detecta (Figura 40B). A més, en tan sols 72 hores després de
treure el tumor els nivells de S100A7 tornen a nivells basals. Per tant, donat que la S100A7
s’elimina amb rapidesa de la sang i està molt lligada a la presència de tumor, podria ser
considerada un bon marcador sanguini de diagnòstic i de recurrència.
Tenint en compte aquests resultats, vam considerar que el model in vivo de la A431
era un bon model per testar l’eficàcia dels anticossos monoclonals anti-S100A7
seleccionats. A més, el tractament hauria de començar un cop els tumors comencessin a
expressar la proteïna (a partir del dia 10 de creixement), per la qual cosa seria necessari
realitzar aquesta comprovació abans d’iniciar el tractament.
Degut a l'experiència prèvia del nostre grup, es va escollir la via d’administració
intraperitoneal i la pauta de tractament de 500 μg/dosi, tres cops per setmana, ja que havia
mostrat ser suficient per veure una eficàcia en el tractament de ratolins amb tumors
subcutanis utilitzant anticossos contra la proteïna S100A4 (Hernandez et al., 2013). Tot i
això, abans de començar l’assaig vam voler confirmar que la via d’administració i la pauta
escollida era suficient per que l’anticòs arribés al tumor de A431 i pogués bloquejar la
S100A7 alliberada. Per això, es van administrar 4 ratolins amb tumors de volums 933, 780,
220 i 210 mm 3 amb 500 μg/dosi d'anticòs 2D9-biotinilat durant 1 setmana (3 dosis en total)
per via intraperitoneal. A continuació, es van extirpar els tumors i es van analitzar per
immunohistoquímica en parafina seguint el protocol detallat a l’apartat 3.6.5.4. de materials i
mètodes. A la Figura 41A es mostra una imatge representativa de la tinció amb
estreptavidina d’un dels tumors tractats amb 2D9-biotinilat i un tumor no tractat.
Com es pot veure, el 2D9-biotinililat arriba al tumor i és detectable sobretot al teixit que
rodeja les zones necròtiques. En aquestes mateixes zones no s’observa tinció en els tumors
no tractats, de manera que podem confirmar que el senyal és específic. Tot i que no
s’observa tinció a la zona viva, no podem descartar que hi hagi anticòs infiltrat ja que
aquesta metodologia és molt poc sensible i només és útil per detectar grans acumulacions
de l’anticòs administrat. Per confirmar els resultats observats, es va realitzar una anàlisi per
western blot dels 4 tumors tractats amb 2D9-biotiniliat, junt amb 4 tumors que no havien
rebut tractament, utilitzant com a anticòs primari l’estreptavidina. Així, vam ser capaços de
detectar la presència de l’anticòs 2D9-biotiniliat que havia arribat al tumor en els animals
tractats, mentre que no es va observar senyal en els animals no tractats (Figura 41B).
154
Resultats
A
Tinció amb streptavidina
B
No tractats
Tractats
2D9-Biot
No tractat
Tractat
amb 2D9-biotinilat
Control negatiu
42 kDa -
β-actina
50 kDa -
2D9-Biot
Figura 41. Localització intratumoral de l’anticòs administrat per via intraperitoneal.
A) Tumors parafinats de ratolins tractats amb 2D9 -biotinilat durant 3 dosis de 500 μg/dosi
o no tractats es van tenyir per immunohistoquímica amb estrept avidina-HRP. Imatges a
200 augments. B) Anàlisi per western blot dels 4 tumors tractats amb 2D9 biotinilat front
de 4 tumors no tractats.
Amb aquests resultats podem confirmar que la via d’administració intraperitoneal amb
una pauta de 3 dosis a la setmana (500 μg/dosi) és una bona opció per assegurar l’arribada
dels anticossos al tumor i que puguin bloquejar la funció extracel·lular de la proteïna
S100A7.
155
4.8.2. Estudi d’eficàcia amb els anti-S100A7 en el model subcutani de la A431
Pes testar l’eficàcia dels anticossos seleccionats i escollir el possible candidat per
portar a desenvolupament, es va utilitzar el model de creixement tumoral subcutani de la
línia cel·lular A431, prèviament caracteritzat.
Com s’ha vist a l’apartat anterior, aquestes cèl·lules comencen a expressar grans
quantitats de S100A7 a partir dels 10 dies de creixement, coincidint amb una reducció del
temps de duplicació del tumor. Tenint en compte aquestes característiques, ens vam
plantejar dos assaigs en funció del moment d’inici del tractament (Figura 42), ja que està
descrit que el volum tumoral inicial pot afectar directament l’eficàcia del fàrmac (Schiffer et
al., 2003).
ASSAIG 1
Administració i.p (durant 30 dies)
500 μg/100 μl (1010100)
Grups: PBS / 2D9 / 2H3 / 6E3 / 6F5 / 8B6 / 9F3
Final assaig:
Injecció
subcutània de
les cèl·lules
Volum (mm 3): 0
- Pes tumoral
- Recol·lecció de sèrum
- Recol·lecció de tumors
130
Comprovació de
l’expressió de
S100A7
300
800
1100
ASSAIG 2
Administració i.p (durant 21 dies)
500 μg/100 μl (1010100)
Grups: PBS / mAb candidat
Figura 42. Disseny experimental de l’estudi d’eficàcia dels anticossos anti -S100A7.
Quatre milions de cèl·lules de la línia tumoral A 431 es van inocular de manera
subcutània al costat dret de 110 rat olins at ímics. Després de comprovar l’expressió de la
3
3
proteïna, es van realitzar 2 assaigs a diferent volum tumoral inicial (130 mm i 300 mm ).
Al final de cada assaig es van recol·lectar mostres per a la seva posterior anàlisi.
Abans de començar el tractament amb els anticossos era necessari comprovar que els
tumors expressaven la proteïna. A dia 8 i a dia 12 de creixement es van sacrificar dos
animals amb tumors de 120 i 80 mm 3, respectivament. Com es veu a la Figura 43, tot i tenir
un volum més gran, el tumor de dia 8 no expressava la proteïna, mentre que el de dia 12 si,
fet que recolza la hipòtesi proposada anteriorment de que l'inici de l’expressió de S100A7 en
la línia A431 està lligada als dies de creixement, més que no pas al volum tumoral.
156
Resultats
Quan la mitjana del volum va arribar a 130 mm 3 (dia 17 de creixement), es van
seleccionar 70 animals amb un volum tumoral entre 78 i 218 mm 3 (SEM = 4.72) i es van
repartir de manera equitativa en 7 grups de 10, per tal de que tots tinguessin la mateixa
mitjana. El tractament amb els anticossos anti-S100A7 (500 μg/animal en 100 μl de PBS) o
amb el vehicle (100 μl de PBS) es va fer per via intraperitoneal 3 cops per setmana fins al
final de l’experiment (dia 30 de tractament). El volum tumoral i el pes dels animals es va
Dia 12
Dia 8
A7rh
seguir al llarg de tot l’experiment.
42 kDa -
β-actina
13 kDa -
S100A7
Figura 43. Expressió de S100A7 en tumors de A431 abans de l’inici del tractament.
Anàlisi per western blot de l’expressió de S100A7 en tumors subc utanis de la línia A431
3
3
extirpats a dia 8 (120 mm ) i dia 12 (80 mm ) de creix ement.
És important remarcar que la línia A431 té un creixement in vivo poc homogeni, donant
tumors amb un creixement exponencial i altres amb un creixement lineal o que, fins i tot,
arriben a enquistar-se i deixen de créixer. Tenint en consideració aquest fet, es van excloure
de l’anàlisi final aquells ratolins amb tumors que evolucionaven molt per sota de la mitjana
del grup (RTV al final de l’experiment inferior a 200), ja que es va considerar que aquests
tumors no estaven tenint un creixement normal, independentment del tractament rebut. Així
doncs, es van haver de descartar 2 ratolins del grup PBS, 3 del grup 2D9, 2 del grup 6F5, 1
del grup 8B6 i 2 del grup 9F3. D’altra banda, es va aplicar el test estadístic de Grubbs
(Grubbs, 1969) per detectar aquells volums tumorals que estiguessin significativament
allunyats de la resta de volums del grup (outliers). Es va detectar 1 animal al grup del 8B6 i
un animal al grup del 9F3, que també es van excloure de l’anàlisi. Per últim, un dels ratolins
del grup 2H3, amb un tumor normal en quant a la seva evolució, va presentar símptomes de
caquèxia i pèrdua significativa de pes a partir del dia 16 de tractament, motiu pel qual es va
sacrificar. Aquest fet, es va considerar com un fet aïllat dins el grup ja que la resta de ratolins
van evolucionar amb total normalitat. Amb tot, els ratolins que es van considerar finalment
per a l’anàlisi de l’efecte del tractament amb els anticossos anti-S100A7 sobre el creixement
tumoral van ser: PBS (n=8), 2D9 (n=7), 2H3 (n=9), 6E3 (n=10), 6F5 (n=8), 8B6 (n=8) i 9F3
(n=7).
157
La Figura 44 mostra el valor de RTV mig dels animals de cada grup comparats
respecte del grup control (PBS). Com es pot observar, l’anticòs 2H3 no va tenir un efecte
significatiu sobre el creixement tumoral en cap moment, igual que va passar amb el 6E3, tot i
que aquest últim presenta una mitjana en volum inferior a la del PBS. L’anticòs 2D9 només
va tenir un efecte significatiu a l’inici del tractament. Els anticossos 6F5, 8B6 i 9F3 van ser
els que van reduir de manera més clara el creixement tumoral, sent el 6F5 l’anticòs més
eficaç.
Una característica important quan el tractament està tenint un efecte sobre el
creixement tumoral és l’agrupació dels volums i la conseqüent reducció de la dispersió. En
concordança, el grup PBS presenta una gran dispersió, igual que els grups 2H3 i 2D9. En
canvi, els grups 8B6, 9F3 i sobretot el 6F5, tenen una dispersió molt petita.
Fixant-nos en la corba del 6F5, veiem que el creixement tumoral arriba pràcticament a
aturar-se entre els dies 10 i 20 de tractament, i després agafa una lleugera pendent, sempre
inferior a l’observada en el grup PBS. El màxim efecte es va obtenir a dia 21 de tractament
amb l’anticòs anti-S100A7 6F5, amb una reducció del volum tumoral del 43% (vegeu Taula 5
de Resultats).
800
800
2D9
ns
700
2H3
ns
700
ns
ns
600
ns
500
RTV (%)
RTV (%)
600
ns
400
ns
300
200
ns
ns
*
*
ns
ns
500
ns
400
ns
300
ns
200
100
ns
ns
ns
ns
100
0
0
0
5
10
15
20
25
30
35
0
5
10
Dies de tractament
800
15
20
25
800
6F5
ns
ns
700
700
*
ns
500
RTV (%)
RTV (%)
600
ns
ns
400
ns
300
ns
200
ns
ns
ns
ns
*
500
**
400
*
300
200
*
*
ns
*
ns
100
100
0
0
0
5
10
15
20
25
30
0
35
5
10
15
20
25
Dies de tractament
Dies de tractament
35
Dies de tractament
6E3
600
30
158
30
35
Resultats
800
800
8B6
9F3
ns
ns
700
700
ns
ns
600
ns
500
RTV (%)
RTV (%)
600
*
400
ns
300
ns
200
ns
**
ns
ns
ns
500
*
400
300
200
ns
**
**
*
**
*
100
100
0
0
0
5
10
15
20
25
30
0
35
5
10
15
20
25
30
35
Dies de tractament
Dies de tractament
Figura 44. Efecte antitumoral dels anticossos anti-S100A7.
6
Cèl·lules de la línia A431 es van inocular de manera subcutània (4x10 ) en ratolins
3
femella atímics. Quan la mitjana del volum tumoral va arribar a 130 mm es va iniciar el
tractament amb els anticossos (500 μg/dosi) o PBS (100 μl) 3 cops per setmana
(1010100). Les corbes mostren la mitja na ± SEM del relative tumor volume (RTV ) de
cada grup: PBS (n=8), 2D9 (n=7), 2H3 (n=9), 6E3 (n=10), 6F5 (n=8), 8B6 (n=8) i 9F3
(n=7). En vermell, la corba corresponent al PBS (grup control). Test U de Mann-Whitney
ns p>0.05, *p<0.05, **p<0.01.
D’altra banda, un fet indicatiu de que el tractament està tenint efectes secundaris sobre
l’animal és la pèrdua de pes, per la qual cosa es va fer un seguiment tres cops per setmana
de la seva evolució. A la Figura 45 es mostra la variació de la mitjana dels pesos de cada
grup al llarg de l’experiment. Com es pot observar, no es van apreciar canvis significatius en
l’evolució del pes dels animals degut al tractament.
G1: PBS
G2: 2D9
G3: 2H3
Pes corporal (g)
30.0
G4: 6E3
G5: 6F5
G6: 8B6
G7: 9F3
27.5
25.0
22.5
20.0
0
5
10
15
20
25
30
35
Dies de tractament
Figura 45. Evolució del pes del s animals durant l’e studi d’eficàcia amb els
anticossos anti -S100A7.
Animals amb tumor de la línia A431 es van tractar 3 cops per setmana amb PBS o amb
els anticossos anti-S100A 7 indicats (500 μg/dosi) durant 30 dies. Les corbes mostren la
159
mitjana ± SEM dels grups: PBS (n=8), 2D9 (n= 7), 2H3 (n=9), 6E3 (n=10), 6F5 (n= 8), 8B6
(n=8) i 9F3 (n= 7).
Al final de l’experiment, es van sacrificar els animals, es van extreure els tumors i es
van pesar i fotografiar. Com es mostra a la Figura 46A, el tractament amb els anticossos
9F3, 6E3 i, sobretot 8B6 i 6F5, va reduir considerablement la mitjana del pes tumoral al final
de l’experiment, tot i que no de manera estadísticament significativa, a causa de la gran
dispersió de grup control (PBS). A la Figura 46B es pot apreciar les diferències entre els
tumors del grup tractat amb PBS, en comparació amb l’homogeneïtat del grup tractat amb
l’anticòs 6F5.
A
ns
0.7
ns
Pes tumoral (g)
0.6
ns
ns
0.5
ns
ns
0.4
0.3
0.2
0.1
0.0
PBS 2D9 2H3 6E3 6F5 8B6 9F3
B
2
3
4
5
6
7
8
G5: 6F5
G1: PBS
1
Figura 46. Tumors de la línia A431 al final de l’assaig.
Després de 30 dies de tractament amb PBS o amb els anticossos anti-S100A7, es van
sacrificar els animals i es van extreure els tumors per a la seva posterior anàlisi. A) P es
tumoral de cada grup de tractament. El gràfic mostra la mitjana ± SEM dels grups: PBS
(n=8), 2D9 (n=7), 2H3 (n=9), 6E3 (n= 10), 6F5 (n= 8), 8B 6 (n=8) i 9F3 (n=7). Test U de
Mann-Whitney ns p>0. 05. B) Fotografia dels tumors del grup control i del grup tractat
amb l’anticòs 6F5.
160
Resultats
A la Taula 5 es mostren les mitjanes i els valors T/C (Tractament/Control) dels
paràmetres estudiats al punt de màxim efecte (dia 21 de tractament) i a punt final de l’assaig
(dia 30 de tractament).
Taula 5. Resultats obtinguts amb el tractament anti-S100A7 en el model subcutani
de la línia A431 (ASS AIG 1).
Punt de màxim efecte (Dia 21 de tractament)
Dosi anti-S100A7 (μg)
3
G1
(PBS)
G2
(mAb 2D9)
G3
(mAb 2H3)
G4
(mAb 6E3)
G5
(mAb 6F5)
G6
(mAb 8B6)
G7
(mAb 9F3)
-
500,00
500,00
500,00
500,00
500,00
500,00
Volum tumoral mig (mm )
507,94
375,65
402,51
359,26
288,41
301,44
319,43
RTV mig (%)
363,57
276,70
333,51
298,43
218,21
261,21
255,35
T/C del volum tumoral (%)
-
0,74
0,79
0,71
0,57
0,59
0,63
T/C del RTV (%)
-
0,76
0,92
0,82
0,60
0,72
0,70
T/C de la variació del pes corporal (%)
Temps de duplicació (dies)
Retràs absolut del creixement (dies)
-
1,53
1,37
1,35
0,90
1,92
1,41
12,34
15,52
13,87
15,98
21,91
18,92
18,06
-
3,18
1,53
3,64
9,57
6,58
5,72
G7
(mAb 9F3)
Punt final (Dia 30 de tractament)
Dosi anti-S100A7 (μg)
G1
(PBS)
G2
(mAb 2D9)
G3
(mAb 2H3)
G4
(mAb 6E3)
G5
(mAb 6F5)
G6
(mAb 8B6)
-
500,00
500,00
500,00
500,00
500,00
500,00
Volum tumoral mig (mm3)
812,79
642,66
771,30
578,62
455,98
459,00
518,12
RTV mig (%)
574,80
494,47
619,84
494,49
359,42
408,69
416,97
0,53
0,48
0,53
0,44
0,35
0,36
0,44
T/C del volum tumoral (%)
-
0,79
0,95
0,71
0,56
0,56
0,64
T/C del RTV (%)
-
0,86
1,08
0,86
0,63
0,71
0,73
T/C del pes tumoral (%)
-
0,90
1,00
0,82
0,66
0,68
0,84
T/C de la variació del pes corporal (%)
-
0,91
1,04
1,19
0,92
1,29
1,06
12,72
13,82
11,55
14,69
20,09
18,07
15,26
-
1,10
-1,17
1,97
7,37
5,35
2,54
Pes tumoral mig (g)
Temps de duplicació (dies)
Retràs absolut del creixement (dies)
Com es pot observar, tant a dia 21 com a dia 30, el 6F5 va ser l ’anticòs més eficaç,
arribant a reduir el volum tumoral en un 44% i fent que el temps de duplicació mig dels
tumors passés de 12.7 dies en el grup PBS a 20.09 dies amb el tractament. L’anticòs 8B6
també va tenir un efecte destacat sobre els tumors, tot i que lleugerament per sota del 6F5.
A més, en la corba del 8B6 no es va observar una frenada tan clara del creixement entre els
dies 10 i 20 de tractament, per la qual cosa vam considerar que l’anticòs 6F5 era el més
eficaç bloquejant l’efecte de la proteïna S100A7.
Com s’ha explicat anteriorment, mentre es feia l’ASSAIG 1, es va continuar fent el
seguiment dels animals sobrants. Quan la mitjana del volum tumoral va arribar a 300 mm 3
(dia 47 de creixement) es van seleccionar aquells animals amb tumors que havien
evolucionat de manera normal, amb volums entre 177 i 477 mm 3 (SEM = 19.45), i es van
repartir en 2 grups de 10 animals de manera que la mitjana del volum de cada grup fos la
161
mateixa. El tractament amb l’anticòs 6F5 (seleccionat del primer assaig) o amb PBS (control)
es va realitzar com s’ha detallat anteriorment.
Seguint els mateixos criteris d’exclusió utilitzats al primer assaig ens vam fixar en
tumors amb una evolució clarament per sota de la mitjana i vam aplicar el test de Grubbs per
eliminar outliers. En aquest cas, no es va descartar cap animal. Aquesta diferència respecte
del primer assaig es deu a que al volum de 300 mm 3 els tumors ja estan ben formats i és
més fàcil descartar d’inici aquells amb evolucions estranyes.
En aquest cas es va tornar a observar un efecte antitumoral a l’inici del tractament,
confirmant així l’eficàcia de l’anticòs 6F5 (Figura 47A). Tot i això, l’efecte no va ser tan clar
com a l’ASSAIG 1, ja que en cap moment hi va haver una frenada del creixement. Cal tenir
en compte que els tumors utilitzats en aquest segon assaig havien tingut una evolució molt
lenta durant tot l’experiment, trigant gairebé 50 dies a arribar a 300 mm 3 de mitjana. Aquest
tumors estaven formats bàsicament per teixit necròtic. De fet, durant la recollida de mostres
al final de l’experiment vam comprovar que els tumors eren líquids per dins, la qual cosa
podria haver limitat l’eficàcia de l’anticòs. En aquest segon assaig tampoc hi va haver un
efecte negatiu sobre el pes dels animals (Figura 47B). A més, en l’anàlisi del pes dels
tumors al final de l’assaig es va veure una diferència considerable entre la mitjana dels dos
grups, tot i que no estadísticament significativa (Figura 47C).
Amb aquests resultats, hem pogut determinar per primer cop que el tractament amb un
anticòs anti-S100A7 pot tenir un efecte sobre el creixement tumoral, demostrant la prova de
principi amb aquest tipus d’aproximació. El model subcutani de la línia tumoral A431 ha
resultat ser un bon model per testar l’eficàcia dels anticossos anti-S100A7, permetent
seleccionar l’anticòs 6F5 com el primer candidat terapèutic.
A més, per a futurs experiments, s’han de tenir en compte una sèrie de factors que
influeixen directament sobre la resposta al tractament. D’un banda s’han de seleccionar
aquells tumors que hagin evolucionat de manera ràpida durant els primers dies des de la
inoculació de les cèl·lules i començar el tractament a volums d’entre 100 i 150 mm 3. Aquells
tumors que triguen massa en arribar al volum desitjat, tenen una elevada necrosis
intratumoral que dificulta l’eficàcia del tractament. A més, els grups de tractament han de ser
d’almenys 10 animals ja que el creixement es molt heterogeni i és difícil obtenir una
significança estadística. Per últim, s’han d’aplicar criteris d’exclusió objectius a tots els grups
per identificar els animals amb evolucions que difereixin de manera important de la mitjana i
descartar-los per a l’anàlisi final dels resultats.
162
Resultats
A
6F5
500
ns
ns
400
RTV (%)
ns
T/C = 0.79
*
300
*
200
*
*
*
*
100
0
0
5
10
15
20
25
Dies de tractament
B
C
T/C = 0.77
1.2
Pes tumoral (g)
Pes corporal (g)
30.0
27.5
25.0
22.5
20.0
1.0
ns
0.8
0.6
0.4
0.2
0.0
0
5
10
15
20
25
PBS
6F5
Dies de tractament
Figura 47. Efecte del tractament amb l’anticòs 6F5 sobre el creixement subcutani
3
de la línia A431 a volum inicial de 300 mm .
Tumors subcutanis de la línia A431 es va tractar amb PBS o amb l’anticòs 6F5 (500
μg/dosi) 3 cops per setmana (n=10). A) Efecte del tractament sobre el volum tumoral.
B) Variació del pes dels animals al llarg de l’experiment. C) Pes dels tumors al final de
l’assaig. Les corbes i el gràfic mostren la mitjana ± SEM. Test U de Mann-Whitney ns
p>0.05, *p<0. 05
Com hem vist, es van seleccionar sis anticossos funcionals en base als assaigs
realitzats en diferents models in vitro, mostrant tots ells una activitat similar. En canvi, tan
sols tres van mostrar una eficàcia considerable en el bloqueig de la proteïna S100A7 in vivo,
destacant per sobre de tots l’anticòs 6F5. Això demostra la gran limitació que existeix en
l’estudi de la funció de la família de les S100 en models in vitro on és necessari l'ús de la
proteïna recombinant per induir una resposta sobre un tipus cel·lular concret. Tot i que els
models in vitro ens serveixen per fer-nos una idea de la funció de la S100A7 i per
seleccionar un grup de possibles candidats terapèutics, no és suficient per escollir amb
fiabilitat el candidat definitiu amb el qual s’entrarà en fases de desenvolupament. La
163
complexitat de la funció de la S100A7 en el microentorn tumoral, interaccionant alhora amb
multitud de tipus cel·lulars, fa que sigui pràcticament impossible reproduir aquesta situació in
vitro de manera que es pugui determinar el comportament dels anticossos dins d’aquest
sistema fora de l’animal. Això marca la importància de l’estudi d’eficàcia en animals per a la
selecció final d'un candidat i la necessitat d’escollir un bon model, el creixement del qual
depengui de la diana bloquejada.
4.8.2.1.
Anàlisi de l'efecte del tractament a nivell histològic
Després de demostrar l'eficàcia dels anticossos monoclonals sobre el creixement
tumoral subcutani de la línia A431, vam voler analitzar l'efecte a nivell tissular per ampliar el
coneixement sobre el paper desenvolupat per la S100A7 en la progressió del tumor.
En aquest apartat ens vam centrar en l’anàlisi de les mostres recol·lectades a
l’ASSAIG 1, on es va veure un major efecte del tractament, i en concret en les mostres dels
grups tractats amb PBS (control) i amb l’anticòs 6F5.
En primer lloc, vam voler determinar la presència de S100A7 en el sèrum dels ratolins.
Tal com s’ha mostrat a la Figura 40, existeix una correlació estadísticament significativa
entre la presència de la proteïna en sang i el volum tumoral. A la Figura 48 es mostra el
resultat dels grups PBS i 6F5 per separat. En el primer, la concentració de S100A7 en sèrum
va tornar a correlacionar amb el volum tumoral, mentre que en el grup del 6F5 no. Això pot
ser degut al fet que els animals tractats amb l’anticòs tenen la S100A7 sèrica totalment
bloquejada per aquests anticossos. Aquest complex S100A7-6F5 es difícil de quantificar
amb el sandwich ELISA, ja que el 6F5 impedeix la correcta unió dels anticossos de captura i
de detecció (9F3 i 2D9). Per comprovar aquesta hipòtesi, es va realitzar el sandwich ELISA
utilitzant el 6F5 com a anticòs de captura. Com a resultat, no es va veure senyal en el sèrum
dels animals tractats, ja que el 6F5 del recobriment no va trobar proteïna lliure per unir-se.
En canvi, en el grup del PBS es van observar nivells de S100A7 similars als obtinguts amb
el sandwich estàndard (dades no mostrades), confirmant la hipòtesi proposada. El resultat
obtingut també ens va confirmar que la dosi i la pauta de tractament escollida va ser
suficient per bloquejar totalment la proteïna S100A7, almenys a nivell circulant.
164
Resultats
Grup 6F5
Grup PBS
30
*** p<0.0001
r2 0.68
75
S100A7 (ng/ml)
S100A7 (ng/ml)
100
50
25
0
0
500
1000
1500
2000
2500
Volum tumoral (mm3)
20
10
0
-10
ns p>0.05
r2 0.32
-20
300
400
500
600
Volum tumoral (mm3)
Figura 48. Nivells de S100A7 al sèrum dels ratolins amb tumor de A431.
Els animals amb tumor subcutani de A431 es van tractar amb PBS o 6F5 durant 30 dies
(n=8). Al final de l’experiment es va analitzar la presència de S100A7 al sèrum. La recta
mostra la relació lineal entre la concentració de S100A7 i el volum tumoral.
Un punt clau per entendre l’efecte del tractament amb l’anticòs 6F5 sobre el
creixement del tumor va ser l’estudi de la vasculatura intratumoral. La formació d’una xarxa
vascular eficient dins el tumor és determinant per al seu creixement (Mittal et al., 2014).
Estudis previs han relacionat la proteïna S100A7 amb processos d’angiogènesi, demostrant
in vitro una inducció de formació de capil·lars per part de cèl·lules endotelials aïllades i un
petit però significatiu augment de la seva proliferació (Shubbar et al., 2012). En els assaigs
realitzats en aquest treball amb la proteïna recombinant s’ha demostrat que la S100A7
indueix la migració de la cèl·lula endotelial HUVEC, a més d'estimular la secreció de
citoquines protumorals, com el GM-CSF o la IL6, entre d’altres.
Per estudiar l’efecte del tractament amb el 6F5 sobre la vasculatura tumoral, es van
realitzar tincions d’immunohistoquímica de talls de teixit fresc amb l’anticòs anti-CD31 murí,
un marcador de membrana de les cèl·lules endotelials de ratolí (Liu and Shi, 2012). Després
de realitzar cinc fotografies de cada tumor, es va quantificar tant el nombre com la mida dels
vasos dins el teixit i es va calcular la densitat microvascular (M.V.D) i la fracció d’àrea
ocupada per vasos (A.A.) per a cada tumor, tal com s’ha descrit a materials i mètodes. A la
Figura 49A es mostren tres imatges representatives de la vasculatura tumoral en el grup
control i en el grup tractat amb l’anticòs 6F5. La quantificació va donar com a resultat un
descens de més del 60% (T/C = 0.37) en l’àrea dels vasos dins el tumor amb el tractament
(Figura 49B), així com un descens important, del 38% (T/C = 0.62), tot i que no
estadísticament significatiu, de la densitat vascular (Figura 49C).
165
Grup 6F5
Grup PBS
A
B
C
T/C = 0.37
3.0
0.030
2.0
**
1.5
1.0
0.5
M.V.D. (v.p./mm3)
0.035
2.5
A. A. (%)
T/C = 0.62
3.5
ns
0.025
0.020
0.015
0.010
0.005
0.0
0.000
G1: PBS
G5: 6F5
G1: PBS
G5: 6F5
Figura 49. Anàlisi de la vasculatura tumoral en el model de la A431.
Després de 30 dies de tractament amb PBS (n=8) o 6F5 (n=8), els tumors de la línia
A431 es van analitzar per immunohistoquímica amb el marcador de cèl·lula endotelial
CD31. A) Imatges representatives de t res tumors del grup control (PBS) i del grup tractat
amb l’anticòs 6F5. B) Fracció d’àrea ocupada per vasos. C) Densitat microvascular. Els
gràfics mostren la mitjana ± SEM. Test U de Mann-Whitney ns p>0.05, **p< 0.01.
Aquests resultats confirmen el paper proangiogènic de la proteïna i és el primer cop
que es demostra que el tractament amb un anticòs anti-S100A7 és capaç d'afectar
directament la vasculatura tumoral.
Un paràmetre que està íntimament lligat a la vasculatura és l’anàlisi de l'àrea necròtica
dins el tumor. Tumors amb una vasculatura eficient reben una aportació de nutrients en tot el
166
Resultats
seu volum suficient per mantenir el seu teixit viu. En canvi, tumors amb una vasculatura
insuficient, per exemple degut a un tractament antiangiogènic, veuen afectat el seu
creixement i perden teixit viu, augmentat l’àrea necròtica (Proskuryakov and Gabai, 2010).
Per avaluar si l’efecte sobre la vasculatura observat amb el tractament amb el 6F5 es
traduïa en un augment de la necrosi intratumoral, es van fer tincions d’hematoxilina/eosina
de talls dels tumors dels grups PBS i 6F5. A la Figura 50A es mostren imatges
representatives de tres tumors de cada grup, on es pot diferenciar clarament l’àrea necròtica
(zona rosada) del teixit viu (zona marronosa). La quantificació dels tumors de cada grup va
mostrar un increment estadísticament significatiu (T/C = 1.21) de l’àrea necròtica amb el
tractament amb l’anticòs anti-S100A7 6F5 (Figura 50B).
Grup 6F5
Grup PBS
A
B
Àrea necròtica (%)
100
T/C = 1.21
*
75
50
25
0
G1: PBS
G5: 6F5
Figura 50. Anàlisi de la necrosi s intratumoral en el model de la A431.
Després de 30 dies de tractament amb PBS (n=8) o 6F5 (n=8), t alls sagitals dels tumors
de la línia A431 es van tenyir amb hematoxilina/eosina. A) Imatges representatives de
tres tumors del grup control (PBS ) i del grup tractat amb l’anticòs 6F5. B) Àrea necròtica
167
mitjana dels tumors analitzats. El gràfic mostra la mitjana ± SEM. Test U de MannWhitney *p<0.05.
Aquests resultats reforcen l’efecte observat sobre la vasculatura tumoral i confirmen
que el tractament amb l’anticòs anti-S100A7 6F5 té un efecte antitumoral, en part, reduint la
seva vascularització i, en conseqüència, augmentant la necrosi dins el teixit, la qual cosa es
tradueix en un descens del creixement del tumor.
4.9. Efecte de la proteïna S100A7 sobre la preparació del nínxol
premetastàtic
Està descrit que, abans de la disseminació metastàtica, el tumor primari secreta
factors que contribueixen a la formació d’un nínxol premetastàtic en òrgans distants,
caracteritzat per la presència de cèl·lules derivades de medul·la òssia, un major nombre de
fibroblasts i la secreció d’oncoproteïnes i citoquines, que formen un entorn adequat per a
l’establiment de les cèl·lules tumorals i el seu creixement (Quail and Joyce, 2013).
En els nostres estudis, hem demostrat que la S100A7 es troba al sèrum dels ratolins
amb tumor subcutani de la línia A431, confirmant els resultats observats en pacients amb
càncer de pulmó, on també s'ha trobat la proteïna en sang (Zhang et al., 2008).
Tenint en compte aquestes dades, vam voler estudiar si la S100A7 alliberada al torrent
sanguini per part del tumor primari podia estar implicada en la formació del nínxol
premetastàtic en òrgans distants, de manera que afavorís l’eventual arribada de les cèl·lules
tumorals i el seu creixement.
Amb aquest objectiu, es va posar a punt un model de metàstasi experimental on,
després de tractar els animals de manera diària amb PBS o amb S100A7 recombinant (per
tal de simular l’efecte del tumor primari) durant 1 setmana (10 animals per grup), es van
inocular les cèl·lules de la línia tumoral murina CT26, de manera intraesplènica. Als 21 dies
de la seva inoculació, es va observar l’aparició de metàstasi al fetge dels ratolins. A la
Figura 51 es mostra un esquema de l’estudi realitzat.
168
Resultats
Injecció
intraesplènica
de les CT26
Implantació i creixement de
metàstasi hepàtiques
Dia: -7
0
21
Final assaig:
- Nº metàstasi
- Recol·lecció fetges
Injecció i.p.
S100A7 / PBS
Figura 51. Estudi de metàstasi experimental en el model de la CT26.
Després de tractar els animals amb S100A7 (100 μg/dia) o PBS per via intraperitoneal
durant 7 dies (n = 10), es van inocular les c èl·lules CT26 (50.000 per animal ) a la melsa
dels ratolins. Als 21 dies es van sacrificar els animals i es va explorar la presència de
metàstasis al fetge.
A dia 2 de tractament es va extreure sang de la vena facial dels animals per tal de
comprovar els nivells de S100A7. Com es mostra a la Figura 52A la proteïna es troba
present en el sèrum dels animals a una concentració similar a l’observada en ratolins amb
tumor d’uns 200 mm 3 en el model de la A431 (20 ng/ml). Si bé es va administrar una
quantitat molt superior (100 μg/dosi), no sorprèn la baixa concentració trobada en sang, ja
que aquesta proteïna s’elimina ràpidament. A més, s’ha de tenir en compte que la proteïna
recombinant administrada és majoritàriament monomèrica, la qual cosa facilita encara més
la seva eliminació. Al llarg de tot l’experiment es va fer el seguiment del pes dels animals,
demostrant que el tractament amb la proteïna S100A7 no afectava la seva evolució (Figura
52B).
B
A
25
**
25
Pes corporal (g)
S100A7 (ng/ml)
30
20
15
10
5
0
23
21
19
PBS
S100A7
17
15
PBS
S100A7
0
10
20
30
40
Dia d'experiment
Figura 52. Seguiment de l’estudi de metàstasi experimental.
A) Anàlisi de la proteïna S100A7 al sèrum dels ratolins a dia 2 de tractament amb la
proteïna recombinant (100 μg/dosi ). B) E volució del pes dels animals. El gràfic i la corba
mostren la mitjana ± SEM. Test U de Mann-Whitney **p<0.01.
169
Al final de l’experiment, es van sacrificar els animals i es van extreure els fetges per
procedir al recompte del nombre i mida de les metàstasis. A la Figura 53A es mostren tres
fetges representatius del grup tractat amb PBS i del grup tractat amb S100A7 i a la Figura
53B es mostra la quantificació del nombre de metàstasis presents. Com es pot observar, el
tractament diari amb la proteïna S100A7 durant una setmana va afavorir la formació de
metàstasis per part de la cèl·lula CT26. En canvi, no es van trobar diferències significatives
en quant a la mida d’aquestes metàstasis. Per tant, podem concloure que la presència de
S100A7 al sèrum dels animals afavoreix l’establiment de les cèl·lules tumorals al fetge,
sense afectar directament el seu creixement, almenys en aquest punt de l’anàlisi. En aquest
sentit, s’ha de tenir en compte que el tractament es va interrompre abans d’administrar les
cèl·lules, per la qual cosa és possible que la proteïna no hagi pogut actuar directament sobre
les cèl·lules implantades.
Grup S100A7
Grup PBS
A
B
T/C = 3.5
**
Mestàstasis hepàtiques (nº)
15.0
12.5
10.0
7.5
5.0
2.5
0.0
PBS
S100A7
Figura 53. Anàlisi del nombre de metàsta si s observades en el model intraesplènic
de la CT26.
Després de 1 s etmana de tractament diari amb PBS o S100A 7 (100 μg) (n = 10), es van
inocular les cèl·lules CT26 de manera intraesplènica. Als 21 dies, es va procedir al
recompt e de les metàstasis hepàtiques. A) Imatge de 3 fetges representatius dels dos
170
Resultats
grups de tractament. B) Quantificació del nombre de metàstasis al fetge. El gràfic mostra
la mitjana ± SEM. Test U de Mann-W hitney **p<0. 01.
Per aprofundir en l’efecte del tractament observat amb la proteïna S100A7, vam voler
estudiar els nivell de fibrotització del teixit hepàtic. Està descrit que un major entrecreuament
de les fibres de col·lagen I (fibrosis) és crític per a l’establiment de cèl·lules mieloides
derivades de la medul·la òssia, que preparen un entorn ideal per a la colonització de les
cèl·lules metastàtiques (Cox et al., 2013).
La tinció amb Picrosirius Red i l’estudi amb llum polaritzada s’ha utilitzat per determinar
la presència d'aquest tipus de col·lagen dins el teixit (Rich and Whittaker, 2005). El color de
les fibres (vermell, taronja, groc i verd) marca el seu gruix o nivell d'entrecreuament (sent les
verdes les més fines). A la Figura 54 es mostra la imatge de tres fetges representatius del
grup tractat amb PBS i amb S100A7. Com es pot observar, el tractament amb la proteïna
recombinant va induir un augment del nombre de fibres entrecreuades presents en el teixit
hepàtic, afavorint, probablement, el reclutament de cèl·lules mieloides que, mitjançant la
secreció de citoquines i oncoproteïnes, formaran l'entorn idoni (nínxol premetastàtic) per al
posterior establiment de les cèl·lules tumorals. En relació a aquests resultats, estudis
recents han descrit que un altre membre de la família, la S100A4, pot actuar com a factor
fibrogènic mitjançant l’activació de les cèl·lules hepàtiques estrellades, que es transformen
en miofibroblasts productores de matriu extracel·lular (Chen et al., 2014b). Estudis més
profunds serien necessaris per determinar el mecanisme real pel qual la proteïna S100A7
indueix una major fibrosis hepàtica i estudiar com afecta la preparació del teixit prèvia a
l'arribada de les cèl·lules tumorals.
Amb tot, és el primer cop que es demostra que la proteïna S100A7 pot estar implicada
en la preparació del nínxol premetastàtic, induint una major fibrotització del teixit. Aquest
resultat indicaria que els tumors primaris que expressin la proteïna S100A7, en alliberar-la a
la sang, estarien afavorint, en òrgans distants, la preparació d’un ambient adequat per a la
implantació de les metàstasis, la qual cosa contribuiria a una major agressivitat del tumor i
una menor esperança de vida del pacient. Per tant, el bloqueig d’aquesta proteïna seria de
gran interès per inhibir aquests mecanismes i dificultar o retardar l’aparició de les
metàstasis.
171
PBS
Camp clar
S100A7
Polarització
Camp clar
Polarització
Figura 54. Anàlisi de la fibrotització del fetge en el model de la CT26.
Fetges dels ratolins tractats amb PBS o amb S 100A7 es van tenyir amb Picrosirius Red i
es van analitzar sota camp clar i llum polaritzada.
4.10. Seqüenciació dels anticossos monoclonals anti-S100A7
Com a pas previ a l’obtenció de les formes humanitzades dels anticossos murins per
avançar en el desenvolupament preclínic d’aquest agents, es va determinar la seqüència de
les regions variables dels anticossos seleccionats en els assaigs in vitro, de forma paral·lela
a la selecció del candidat funcional.
A partir del cDNA de cadascun dels 6 hibridomes, es va amplificar la seqüència de la
regió variable tant de la cadena pesada (VH ) com de la lleugera (VL). Per assolir-ho, es va
utilitzar una barreja d’encebadors degenerats (vegeu Taula 3 de materials i mètodes), ja que
172
Resultats
la seqüència de la regió variable és única i desconeguda per a cada anticòs. En concret, es
van utilitzar encebadors que s’unien a la regió del pèptid senyal (PS) o al framework 1 (FR1)
per l’extrem 5’ i al framework 4 (FR4) o a la regió constant (cnt) per l’extrem 3’, donant lloc a
4 combinacions possibles (PS+FR4, PS+cte, FR1+FR4 i FR1+cte) (vegeu Figura 3 de
Materials i Mètodes). En els casos en què va ser possible, es va seleccionar la seqüència
amplificada amb la combinació PS+cte, ja que era l’única que contenia la seqüència
complerta de la regió variable.
En alguns casos, no va ser possible amplificar la seqüència de la regió variable
utilitzant els encebadors de PS i es va obtenir la seqüència utilitzant la combinació
d’encebadors FR1+cnt, tot i les limitacions que ens aporta. Un cop coneguda la seqüència
nucleotídica d’aquesta seqüenciació parcial, es van buscar seqüències similars en bases de
dades i es van dissenyar encebadors específics en base al pèptid senyal de les seqüències
més homòlogues, per tal d’amplificar la seqüència sencera. Va ser el cas de la cadena
pesada del 8B6 i de la cadena lleugera del 9F3.
Durant la seqüenciació dels anticossos, s’ha de tenir en compte que la línia de
mieloma utilitzada per obtenir els hibridomes (derivada de p3-X63-Ag8.653) té el seu origen
en el clon MOPC-21, que expressa de manera endògena mRNA d’una cadena lleugera
aberrant. Aquesta seqüència mai arriba a traduir-se en una cadena lleugera completa ja que
té un codó stop abans del CDR3, impedint la traducció de la seva regió constant (Carroll et
al., 1988). En alguns casos, el gen d’aquesta cadena aberrant és silenciat o fins i tot perdut
a la cèl·lula poliploide, però no sempre és així. Degut a l’ús d’encebadors degenerats, es pot
donar el cas que en comptes d’amplificar-se la cadena lleugera funcional, s’amplifiqui la
seqüència de la cadena aberrant. Quan s’analitza la seva seqüència de proteïnes, és
fàcilment reconeixible ja que li falta la cisteïna que dóna inici al CDR1. En el nostre cas, la
cadena lleugera amplificada a partir del cDNA de l’anticòs 9F3 va resultar ser aberrant. Per
evitar aquest problema, es van dissenyar uns encebadors específics contra la cadena
aberrant, per tal de fer la comprovació de les seqüències amplificades abans d’enviar-les a
seqüenciar i descartar falsos positius.
Un cop obtinguda la seqüència dels anticossos murins, es va aplicar la numeració del
Kabat a cada aminoàcid de la seqüència utilitzant l’eina Abnum disponible al web
www.bioinf.org.uk del grup del Dr. Andrew C.R. Martin (University College London)
(Abhinandan and Martin, 2008). Aquesta numeració ens va permetre identificar els CDRs i
els residus de la zona de Vernier, tal com s’explica a continuació.
La determinació dels CDRs dins la seqüència és va fer tal com està descrit pel Dr.
Andrew C. R. Martin (Martin, 2010), de manera que:
173
Per a la cadena lleugera:
CDR-L1
Comença
Aproximadament al residu 24
Residu abans
Sempre C (Absent en les cadenes aberrants)
Residu després
Sempre W. Típicament W-Y-Q, però també, W-L-Q, W-F-Q, WY-L
Longitud
De 10 a 17 residus
CDR-L2
Comença
Sempre 16 residus després del final de CDR-L1
Residu abans
Generalment I-Y, però també, V-Y, I-K, I-F
Longitud
Sempre 7 residus
CDR-L3
Comença
Sempre 33 residus després del final de CDR-L2
Residu abans
Sempre C
Residu després
Sempre F-G-X-G
Longitud
De 7 a 11 residus
Per a la cadena pesada:
CDR-H1
Comença
Aproximadament al residu 26 (Sempre 4 després de C)
Residu abans
Sempre C-X-X-X
Residu després
Sempre W. Típicament W-V, però també W-I, W-A
Longitud
De 10 a 12 residus
CDR-H2
Comença
Sempre 15 residus després del final de CDR-H1
Residu abans
Típicament L-E-W-I-G, però hi poden haver variacions
Residu després
K / R-L / I / V / F / T / A-T / S / A
Longitud
De 16 a 19 residus
CDR-H3
Comença
Sempre 33 residus després del final de CDR-H2
174
Resultats
Residus abans
Sempre C-X-X. Típicament C-A-R
Residus després
Sempre W-G-X-G
Longitud
De 3 a 25 residus
A banda dels residus corresponents als CDRs, existeixen una sèrie d’aminoàcids
essencials per al manteniment de la integritat estructural i l’afinitat de l’anticòs per l’antigen.
Aquests residus pertanyen a la zona de Vernier i van ser identificats per primer cop per
Foote i Winter (Foote and Winter, 1992).
Seguint la numeració del Kabat, els aminoàcids pertanyents a la zona de Vernier per a
la cadena pesada i la cadena lleugera es mostren a la Taula 6.
Taula 6. Residus de la zona de Vernier (numeració del Kabat)
Cadena
Residus (segons numeració del Kabat)
Cadena lleugera (VL)
2, 4, 35-36, 46-49, 64, 66, 68-69, 71, 98
Cadena pesada (VH)
2, 27-30, 47-49, 67, 69, 71, 73, 78, 93-94, 103
A la Figura 55 es mostren les seqüències de la cadena pesada i la cadena lleugera
dels sis anticossos murins amb els CDRs i els residus de la zona de Vernier marcats. La
identificació d’aquests aminoàcids és essencial a l’hora de dissenyar la forma humanitzada
de l’anticòs, com veurem a l’apartat 4.11.
175
Figura 55. Seqüències d’aminoàcids dels anticossos monoclonal s seleccionats.
En groc, els aminoàcids dels CDRs, i, en verd, els aminoàcids de la zona de Vernier de
la regió variable de la cadena lleugera (V L) i la cadena pesada (V H ) dels anticossos
murins.
4.11. Disseny de la forma humanitzada de l’anticòs 6F5 mitjançant
el mètode de CDR-grafting
L’adaptació de la seqüència d’aminoàcids dels anticossos murins per poder ser
utilitzats en el tractament de diferents malalties en humans, és un pas imprescindible en el
desenvolupament preclínic d’aquests agents terapèutics. Aquest procés es coneix com
humanització i es basa en el trasllat dels CDRs de l’anticòs murí d’interès, a un esquelet
humà, per tal d’evitar la reacció immunogènica del pacient, produint els anomenats HAMA
(human anti-murine antibody) (Presta, 2006).
Com s’ha explicat a la introducció, les primeres aproximacions en aquest sentit, que
consistien en incorporar els CDRs dins una regió variable completament humana, van
suposar una pèrdua significativa de l’afinitat de l’anticòs pel seu antigen degut a problemes
en l’estructura tridimensional. Investigacions posteriors van desvelar l’existència d’alguns
aminoàcids essencials en el manteniment de la integritat estructural de l’anticòs i que era
necessari conservar per evitar la pèrdua d’afinitat, eren els anomenats residus de la zona de
Vernier (Foote and Winter, 1992). Actualment, s’estan utilitzant per a la teràpia en humans
diversos anticossos humanitzats mitjançant el sistema de CDR-grafting que consisteix a
modificar aquells residus de la regió variable murina susceptibles de crear immunogenicitat
en humans, conservant tant els residus dels CDRs com els de la zona de Vernier (Ewert et
al., 2004).
Tenint en compte aquestes consideracions, es van utilitzar dos alternatives per obtenir
la seqüència humanitzada de l’anticòs candidat 6F5:
176
Resultats
1) Per a la regió variable tant de la cadena pesada com de la cadena lleugera de
l’anticòs a humanitzar, es van seleccionar les 10 seqüències proteiques humanes
més homologues a la seqüència murina utilitzant la base de dades del Protein
BLAST® (NCBI).
2) Es van utilitzar les eines d’anàlisi IMGT/V-QUEST (Giudicelli et al., 2004) i
IMGT/Junctions (Yousfi Monod et al., 2004) per identificar gens humans de la línia
germinal amb una regió variable altament homòloga a la seqüència nucleotídica de
l’anticòs murí.
Per comparació de les seqüències proteiques humanes en front de la murina, es van
identificar aquells residus diferencials susceptibles de ser modificats, excloent els que
formaven part dels CDRs o de la zona de Vernier.
Per a realitzar els canvis dels residus de la seqüència murina per residus presents en
la seqüència humana, es van tenir en compte els següents criteris:
-
Residus inusuals: utilitzant l’eina AbCheck (Martin, 1996) disponible al web
http://bioinf.org.uk es van analitzar les seqüències de proteïnes de cada cadena
per tal d’identificar residus poc habituals en la posició en què es troben a la
seqüència murina. Aquests residus podrien ser importants en el reconeixement de
l’antigen o per a la integritat estructural de l’anticòs, per la qual cosa que no és
recomanable modificar-los.
-
Distribució: utilitzant l’eina AbYsis disponible al web http://bioinf.org.uk es va
estudiar la freqüència de cada aminoàcid murí en la seva posició per a anticossos
humans. Així, podem decidir no modificar un residu murí si és relativament
freqüent en la cadena humana, tot i que les cadenes humanes més homòlogues no
el continguin, ja que és poc probable que generi una reacció immunogènica.
-
Propietats de l’aminoàcid: si les cadenes humanes homòlogues a la murina donen
dues opcions diferents per a una mateixa posició, el residu murí es canviarà per
l’aminoàcid que tingui la cadena lateral més semblant a la murina, idealment que
pertanyi al mateix grup.
Tenint en compte totes aquestes consideracions, es van dissenyar dues versions de la
forma humanitzada de l’anticòs 6F5 (una en base a l’homologia per BLAST i l’altre en base a
la línia germinal). Posteriorment, aquesta regió variable humanitzada, s’introduirà dins d’uns
vectors que contenen les regions constants de la cadena pesada i la cadena lleugera d’un
anticòs humà (IgG1/kappa).
177
Per raons de propietat intel·lectual, no és possible mostrar les seqüències
humanitzades obtingudes.
Per seleccionar la forma humanitzada final, serà necessari produir l’anticòs i realitzar
estudis per comprovar que no hi ha pèrdua d’afinitat per l’antigen i que la seva eficàcia no es
veu afectada per la modificació de la seva seqüència.
178
Resultats
179
Discussió
5. DISCUSSIÓ
Els
avenços
en l’enteniment dels
mecanismes
i processos
subjacents
al
desenvolupament tumoral han obert la possibilitat d’introduir noves estratègies terapèutiques
dirigides (targeted therapies), basades en un major coneixement de les característiques
intrínseques de les cèl·lules canceroses i dels components (cèl·lules i factors solubles) del
seu microentorn. Aquests nous fàrmacs, en combinació amb la quimioteràpia i la
radioteràpia, contribueixen a combatre el creixement del tumor i la progressió metastàtica.
Tot i això, alguns tractaments tenen un benefici clínic petit o efectes secundaris inesperats,
que limiten el seu ús. Per tant, continua existint una gran necessitat d’introduir noves
aproximacions terapèutiques que complementin l’efecte dels fàrmacs utilitzats actualment a
la pràctica clínica.
En els darrers anys, s’ha demostrat la importància dels diferents components de
l’estroma tumoral (ECM, cèl·lules endotelials, cèl·lules immunes, fibroblasts, etc.) que,
mitjançant contactes directes i l’establiment d’una xarxa de comunicació paracrina, donen
suport a la cèl·lula cancerosa, contribuint activament en l’avenç de la malaltia i en
l’adquisició de resistències a les teràpies antitumorals. En aquest sentit, la identificació
d’aquells factors centrals en el diàleg entre els diferents tipus cel·lulars, serà determinant per
definir noves teràpies i potenciar l’efecte dels tractaments.
Entre els factors implicats en aquesta comunicació cel·lular, es troba la família de les
proteïnes d’unió a calci S100. Alguns membres d’aquesta família s’han trobat
sobreexpressats en multitud de processos patològics, sovint relacionats amb una inflamació
del teixit associada a la malaltia. Entre altres efectes, s’ha descrit que les proteïnes S100
poden induir el moviment i la proliferació cel·lular, afavorint la supervivència de la cèl·lula
tumoral davant de l’atac del sistema immune o dels fàrmacs antitumorals. En aquest sentit,
alguns membres de la família de les S100 s’han postulat com a possibles dianes
terapèutiques.
Un membre d’aquesta família, la S100A7, s’ha trobat sobreexpressada en tumors de
diferents orígens (pulmó, mama, pell, bufeta, cap i coll, laringe, esòfag, estómac i ovari)
correlacionant la seva presència amb un mal pronòstic per al pacient. En els darrers anys
aquesta proteïna ha guanyat protagonisme, centrant l’interès de diversos grups
investigadors i donant lloc a un nombre creixent de publicacions, dirigides a entendre la seva
funció tant a nivell intracel·lular com extracel·lular, que complementen els resultats obtinguts
durant la realització d’aquest treball. Per exemple, s’ha vist que, mentre que en condicions
181
fisiològiques la S100A7 té una funció extracel·lular poc rellevant, en processos patològics
com el càncer la seva acció, via el receptor RAGE, està involucrada en la migració de
limfòcits (Wolf et al., 2008), neutròfils (Jinquan et al., 1996) i cèl·lules tumorals (Kataoka et
al., 2012) o en la proliferació de cèl·lules endotelials, induint la secreció de factors com el
VEGF (Shubbar et al., 2012). A més, en models animals de creixement tumoral s’ha vist que
la S100A7 participa en el reclutament de macròfags (Nasser et al., 2012), en l’angiogènesi
(Paruchuri et al., 2008) i en l’establiment de les metàstasis (Emberley et al., 2003a).
El conjunt de dades publicades fins a l’inici d’aquest treball, a finals de l’any 2010,
oferia una visió poc integrada del paper real de la proteïna en el desenvolupament tumoral,
deixant molts punts per determinar al voltant del seu mecanisme d’acció. Per tant, els
objectius principals d’aquesta tesi van ser aprofundir en l’estudi del mecanisme d’acció de la
S100A7 sobre diferents compartiments cel·lulars dins el tumor, com són la cèl·lula
endotelial, la cèl·lula immune, el fibroblast i la cèl·lula tumoral, i validar la proteïna com una
nova diana terapèutica per al tractament del càncer.
Prèviament, el nostre grup havia demostrat que el bloqueig mitjançant anticossos
monoclonals d’un altre membre de la fam ília, la S100A4, reduïa el creixement tumoral en
models animals de càncer de pàncrees (vegeu apartat 8) (Hernandez et al., 2013). Aprofitant
aquesta experiència, es va decidir seguir la mateixa aproximació per al bloqueig de la
S100A7 i demostrar la prova de principi de la teràpia antitumoral basada en l’ús d’anticossos
monoclonals contra aquesta proteïna.
A més de l’aproximació terapèutica, es va voler estudiar la possible implicació de la
S100A7 com a biomarcador de diagnòstic tumoral. Alguns estudis havien descrit que
aquesta proteïna es trobava en quantitats significatives en biofluids com la sang i l’orina de
pacients amb càncer de pulmó (Zhang et al., 2008) o bufeta (Ostergaard et al., 1999),
respectivament. En aquest sentit, com a tercer objectiu d’aquesta tesi, ens vam plantejar
aportar noves dades sobre el seu valor diagnòstic i de recurrència, analitzant biofluids
derivats de models animals, mitjançant l’ús d’un sistema de detecció de tipus sandwich
ELISA desenvolupat al nostre laboratori.
5.1. Paper de la proteïna S100A7 en el microentorn tumoral
Com a punt de partida per a l’estudi de la funció de la proteïna S100A7 en el
microentorn tumoral, es va seleccionar una línia cel·lular representativa de cadascun dels
compartiments de l’estroma: cèl·lula endotelial (HUVEC), cèl·lula immune (THP1) i cèl·lula
fibroblàstica (BJ), a més de 3 línies tumorals humanes. Dues d’aquestes, eren derivades de
182
Discussió
càncer de mama triple negatiu i s’havia demostrat una correlació positiva entre la presència
de la proteïna i el desenvolupament tumoral. Per exemple, la MDA-MB-231 (que no
expressa la S100A7 de manera endògena), incrementava la seva capacitat proliferativa,
invasiva i metastàtica quan s’induïa la seva sobreexpressió (Emberley et al., 2003a; Nasser
et al., 2012). En canvi, la MDA-MB-468 (amb expressió endògena de S100A7), veia reduït el
seu creixement in vivo i la seva capacitat metastàtica quan s’inhibia l’expressió amb un
shRNA (Krop et al., 2005). La tercera línia tumoral amb la que es va treballar va ser la A431
(carcinoma epidermoide), seleccionada pel fet que només expressava la proteïna durant el
seu creixement in vivo en un model subcutani, suggerint una possible dependència de la
S100A7 per la seva evolució.
Durant el desenvolupament tumoral, existeixen funcions cel·lulars crucials per l’avenç
de la malaltia. D’una banda la capacitat proliferativa de les cèl·lules determinarà la velocitat
de creixement del tumor i les metàstasis, així com la seva vascularització. D’altra banda, una
major capacitat de moviment facilitarà l'extravasació de les cèl·lules tumorals cap al torrent
sanguini, augmentant la probabilitat de metastatitzar en òrgans distants. A més, la resposta
a factors quimiotàctics és important també per a les cèl·lules endotelials, ja que els permet
formar nous vasos, i per les cèl·lules immunes i els fibroblasts, incrementant la seva
presència dins de la massa tumoral. Regulant aquest conjunt de processos cel·lulars, es
troben implicats multitud de factors solubles, secretats pels diferents tipus cel·lulars de
manera activa o passiva, entre els quals es troba la S100A7.
Així doncs, per determinar la funció cel·lular d’aquesta proteïna es va analitzar la seva
implicació en processos de proliferació, adhesió i migració, utilitzant els sis models cel·lulars
escollits prèviament. Com a primer resultat, i després de nombroses variacions en les
condicions d’assaig, es va veure que la S100A7 no té un paper inductor de la proliferació
cel·lular. Aquest resultat contradiu els estudis realitzats per Shubbar i altres on observaven
un increment del nombre de cèl·lules endotelials després de l’estímul amb la proteïna
(Shubbar et al., 2012). Val a dir que l’estudi del paper d’aquesta proteïna en la divisió
cel·lular ha donat lloc a resultats contradictoris en els darrers anys. Per exemple, s’ha vist
que les cèl·lules de càncer de mama amb sobreexpressió induïda de la S100A7
augmentaven lleugerament la seva velocitat de creixement in vitro (Emberley et al., 2003a;
Nasser et al., 2012), mentre que, quan s’inhibia la seva expressió en altres línies cel·lulars
de la mateixa indicació, també s’observava un augment de la proliferació (Krop et al., 2005).
Altres membres de la família, en canvi, han mostrat un paper clarament proliferatiu, com per
exemple la S100P, que incrementa la capacitat proliferativa de cèl·lules de càncer de còlon
(Fuentes et al., 2007) i de càncer de pàncrees (Arumugam et al., 2005). En aquest sentit, el
nostre grup va confirmar l’efecte extracel·lular d’aquesta proteïna (vegeu apartat 8) (Dakhel
183
et al., 2014). De manera similar, la S100A8/A9 i la S100A14 a baixes concentracions també
estimulen la divisió cel·lular en línies de càncer de mama (Ghavami et al., 2008) i de càncer
d’esòfag (Jin et al., 2011), respectivament. Aquest fet mostra que, tot i la similitud estructural
que existeix entre els diferents membres de la família de les S100 i que actuen en molts
casos a través del mateix receptor, les seves funcions poden ser molt diverses.
Un altre efecte que s’observava quan s’induïa la sobreexpressió de la S100A7 en
cèl·lules de càncer de mama era que hi havia una pèrdua de l’adhesió cel·lular i un augment
de la capacitat de moviment i invasió (Emberley et al., 2003a). A més, com s’ha dit
anteriorment, el paper d'aquesta proteïna com a factor quimiotàctic va ser descrit per
leucòcits i cèl·lules d’osteosarcoma. En concordança amb aquests resultats i ampliant
l’estudi als diferents tipus cel·lulars que es troben dins el tumor, es va observar que la
S100A7 augmentava de manera molt important la capacitat migratòria de tots els tipus
cel·lulars estudiats (tumoral, endotelial, immune o fibroblast), indicant que aquesta seria una
de les seves funcions principals quan es troba secretada al microentorn tumoral. Aquest fet
comú dóna un valor afegit a la proteïna com a diana terapèutica, ja que el seu bloqueig
estaria afectant
alhora diferents
compartiments
dins
del tumor, provocant
una
desestabilització del sistema que podria ocasionar una reducció de l’agressivitat de la
malaltia i obrir l’oportunitat per a que altres fàrmacs antitumorals puguin actuar amb una
major eficàcia.
En la migració cel·lular, però, no només participen els factors quimiotàctics, sinó que
també són d’una gran rellevància les proteïnes de la matriu extracel·lular a les quals
s’uneixen les cèl·lules per fer possible el seu moviment. Està descrit que alguns factors
solubles queden ancorats a la ECM, protegint-se de la degradació i dirigint el moviment
cel·lular gràcies a la formació de gradients de concentració (Wilgus, 2012). Tenint en compte
que les S100 poden ser secretades a l’espai extracel·lular i que poden interaccionar amb
components de la matriu, com s’ha descrit per la S100A4 (Li et al., 2002), ens vam plantejar
estudiar la possibilitat de que la S100A7 pogués actuar com a proteïna d’adhesió per
diferents tipus cel·lulars. Després de realitzar els assaigs corresponents, vam veure que la
cèl·lula endotelial HUVEC i la cèl·lula fibroblàstica BJ són capaces d’unir-se sobre una
matriu de S100A7. Així doncs, podríem pensar que, si la S100A7 queda ancorada a la
matriu extracel·lular, podria actuar dirigint el moviment de determinats tipus cel·lulars, no
només per activació de vies de senyalització que ho possibilitin (induint una major capacitat
migratòria), sinó també d’una manera física, actuant com a proteïna d’adhesió. A més, el fet
que no totes les cèl·lules puguin adherir-se sobre la matriu de S100A7, fa pensar que
existeixen unes característiques intrínseques en aquestes cèl·lules, segurament a nivell
d’expressió de determinades proteïnes de membrana, que possibiliten aquest efecte.
184
Discussió
A més de la unió de la cèl·lula a la matriu de S100A7, vam voler determinar l’efecte
induït per la proteïna exògena en l’adhesió de la cèl·lula monocítica sobre una monocapa de
cèl·lules endotelials, simulant una situació real in vivo i que és necessària per al reclutament
d’aquest tipus cel·lular cap als teixits. Està descrit que factors com el TNFα activen les
cèl·lules endotelials, induint un augment de l’exposició en membrana de molècules com la
ICAM-1 o la VCAM-1 (Ramana et al., 2004). D'aquesta manera, les cèl·lules monocítiques
són capaces d’adherir-se a l'endoteli amb major facilitat, afavorint la seva extravasació cap
als teixits. La presència de S100A7, però, no va tenir cap efecte en l’adhesió de les THP1,
després d’haver estimulat les cèl·lules endotelials prèviament i retirat la proteïna abans
d’afegir els monòcits. En canvi, sí que vam observar una major adhesió quan la proteïna es
trobava present junt amb les cèl·lules monocítiques. Aquesta situació és més propera al que
passaria en un tumor, ja que la S100A7 secretada arribaria al torrent sanguini, dipositant-se
sobre l'endoteli i marcant aquests vasos per que les cèl·lules inflamatòries tinguin més
facilitat per adherir-se i extravasar en aquest teixit. Un efecte similar es va descriure pel
dímer S100A8/A9 que, en ser secretat en els teixits amb inflamació localitzada, es diposita a
l'interior de la capa vascular per afavorir el reclutament de cèl·lules immunes (Robinson et
al., 2002). Aquest efecte de la proteïna S100A7, junt amb la seva funció quimiotàctica, es
trobaria en concordança amb els estudis realitzats per altres investigadors on es va veure
que tumors ortotòpics derivats de cèl·lules de càncer de mama amb sobreexpressió induïda
de S100A7, tenen un major nombre de macròfags infiltrats (concretament del tipus M2), que
els tumors sense expressió de la proteïna (Nasser et al., 2012).
Per tant, dels estudis funcionals realitzats en aquest treball hem pogut concloure que
la proteïna S100A7 indueix una major capacitat migratòria de les cèl·lules, podent actuar, a
més, com a proteïna d’adhesió per dirigir el moviment de determinats tipus cel·lulars.
Aquesta proteïna estaria participant en el reclutament de cèl·lules immunes, no només per la
seva funció com a factor quimiotàctic, sinó també afavorint l'adhesió dels monòcits a
l’endoteli vascular, la qual cosa facilitaria la seva extravasació. Això reforçaria la importància
de la S100A7 en la progressió tumoral (disseminació, angiogènesi, inflamació protumoral,
etc.), correlacionant la seva presència amb un mal pronòstic per al pacient.
Un punt de gran interès en l’estudi de la S100A7 com a diana terapèutica va ser
determinar el seu efecte, no només validant-la a nivell cel·lular, sinó també a nivell dels
factors secretats en resposta a ella. La xarxa de comunicació activada per la S100A7 pot
explicar, en bona part, la seva importància en la progressió de la malaltia i el possible efecte
del seu bloqueig com a estratègia terapèutica. Amb aquesta idea, es va analitzar el
sobrenedant de la cèl·lula tumoral, la cèl·lula immune, la cèl·lula fibroblàstica i la cèl·lula
endotelial, en busca de factors diferencialment secretats en presència i en absència de la
185
proteïna. Bibliogràficament, estava descrit que l’estímul de cèl·lules endotelials amb la
proteïna, induïa un augment de la secreció de VEGF (Shubbar et al., 2012). A més, en
cèl·lules de càncer de mama amb sobreexpressió de S100A7 s’observava també un
augment en l'expressió de VEGF, així com d’altres factors relacionats amb la progressió
tumoral, com són el CXCL1 (GRO), CXCL8 (IL8), IL1α, IL11 i GM-CSF (Nasser et al., 2012).
En els nostres estudis, es va comprovar que l’estímul amb la proteïna S100A7 induïa
un efecte diferent en cadascun dels tipus cel·lulars. Tot i que la cèl·lula monocítica i la
cèl·lula endotelial van ser les que van mostrar majors canvis a nivell de secreció de
citoquines, els quatre tipus cel·lulars estudiats van respondre a la proteïna augmentant la
secreció de factors relacionats amb l’angiogènesi i la inflamació tumoral.
Per exemple, en el cas de la línia tumoral A431, es va veure que tres dels factors que
mostraven un increment més significatiu en presència de S100A7 van ser el GM-CSF, el
GRO i la IL8, coincidint amb les observacions fetes per Nasser i altres. Aquest fet indicaria
que possiblement els resultats obtinguts per aquest grup siguin deguts a que la cèl·lula
transfectada secreti la proteïna al medi i que aquesta, a través de l’activació autocrina del
seu receptor, sigui la que indueix l’expressió i secreció dels diferents factors.
A nivell inflamatori, s’ha vist que, en resposta a S100A7, la cèl·lula tumoral, la cèl·lula
endotelial i el fibroblast augmenten la secreció de factors com el GM-CSF, el GRO, la IL-8 i
els MCPs, que es troben també relacionats amb el reclutament de cèl·lules immunes cap al
tumor. Així doncs, aquesta proteïna estaria participant en la creació d’un entorn
proinflamatori, no només actuant directament sobre els leucòcits, sinó també induint la
secreció d’altres factors que potencien el seu efecte.
A més, en la línia cel·lular monocítica es va observar un canvi morfològic important en
resposta a la proteïna, adquirint un fenotip semblant al dels macròfags. El perfil de secreció
de citoquines obtingut en presència de la S100A7 (increment de GRO, MCP-1 i MMP9, entre
d’altres) suportaria la idea de que la proteïna està induint una diferenciació dels monòcits a
macròfags i, en concret, al fenotip M2 (protumoral), ja que aquests factors han estat
relacionats amb aquest tipus cel·lular (Bettum et al., 2014). Per tant, podríem dir que la
proteïna, no només indueix una major infiltració de monòcits dins el teixit tumoral, sinó que
també afavoreix la seva diferenciació cap a macròfags M2, que contribuiran, al seu torn, a la
progressió de la malaltia.
A nivell angiogènic, vam observar que la S100A7 indueix la secreció per part dels
diferents tipus cel·lulars de factors proangiogènics com el VEGF, el TNFα, l’angiopoietina o
el PDGF, que potenciarien l’efecte de la proteïna sobre la cèl·lula endotelial. A més, cal
186
Discussió
destacar que en la HUVEC es va observar un augment en els receptors VEGFR1 i VEGFR2,
la qual cosa indicaria, tot i que no hem vist un efecte sinèrgic entre la S100A7 i el VEGF, que
la proteïna podria predisposar a la cèl·lula endotelial a respondre al factor de creixement,
d’una manera similar a la que faria la S100A4 (Hernandez et al., 2013).
El paper promigratori de la S100A7, a més, es veu reforçat pel fet que alguns dels
tipus cel·lulars estudiats van incrementar la secreció de la MMP9 en resposta a la seva
presència. Està descrit que el moviment de les cèl·lules dins dels teixits és depenent, en
molts casos, de l’activitat de les metal·loproteïnases de la matriu i que alguns membres de la
família de les S100 indueixen la secreció de MMP, com és el cas, per exemple, de la
S100A4, que indueix un increment en la secreció de formes actives de la MMP9 en cèl·lules
endotelials (Hernandez et al., 2013), o el dímer S100A8/A9 que indueix la secreció de MMP2
i MMP12 en cèl·lules tumorals de càncer gàstric (Kwon et al., 2013). A més, en concordança
amb els nostres resultats, alguns estudis mostren que cèl·lules de càncer de mama amb
sobreexpressió de la S100A7 augmentaven la secreció de MMP13 (Emberley et al., 2003a) i
de MMP9 (Nasser et al., 2012; Sneh et al., 2013), a més d’adquirir una major capacitat
invasiva. Cal destacar que, en el cas de la cèl·lula endotelial, no només es va observar un
increment de la secreció de MMP9, sinó també un augment de la seva activitat, la qual cosa
podria indicar que la proteïna S100A7 estaria activant alhora enzims que participen en la
degradació de la pro-MMP9 per donar lloc a la seva forma activa. En aquest sentit, s’ha vist
que, per exemple, la S100A10 pot unir-se al plasminogen (Kwon et al., 2002), facilitant la
seva degradació per part d’altres enzims, com el tPA. La plasmina resultant es troba
involucrada en l’activació de les pro-MMP.
Cal destacar que, tot i que alguns dels factors que s’han trobat incrementats en els
nostres estudis en resposta a la S100A7 ja estaven descrits per altres tipus cel·lulars i altres
membres de la família, d’altres, com ara RANTES, no es veuen afectats per la proteïna,
mentre que juguen un paper important en la resposta a algunes S100 (per exemple la
S100A4) (Forst et al., 2010). Per tant, es demostraria novament que, tot i la similitud entre
els diferents membres, existeixen diferencies importants en les seves funcions i també en la
resposta induïda sobre els diferents tipus cel·lulars, convertint-les en actors independents en
el desenvolupament tumoral (cada actor, una estratègia terapèutica pròpia).
El conjunt de resultats obtinguts en aquesta part del treball demostra que la presència
de la proteïna S100A7 en el microambient tumoral afavoreix la creació d’un entorn
proinflamatori i proangiogènic, via la secreció de diferents citoquines. Aquests factors
contribueixen, junt amb la pròpia S100A7, a la formació vascular, el reclutament de cèl·lules
immunes i la capacitat invasiva de les cèl·lules tumorals.
187
Un cop demostrada la importància de la proteïna en el microentorn tumoral, vam voler
aprofundir en l’estudi de les vies de senyalització implicades en la seva resposta. Està
descrit que, després de la interacció amb els seu receptors, les S100 poden induir diferents
respostes a la cèl·lula a través de l'activació de les MAPK i del factor de transcripció NFkB,
entre d'altres vies (Chen et al., 2014a). A més, s’ha vist que la proteïna S100A7 és capaç
d’induir la fosforilació d’ERK1/2 en cèl·lules de la microglia a través de la unió amb el
receptor RAGE (Jansen et al., 2013). Per realitzar aquest estudi es van seleccionar dos
punts finals de la via, com són la secreció de GM-CSF i de MMP9 en la cèl·lula endotelial
HUVEC, aprofitant que aquesta línia mostrava una bona reactivitat en presència de la
proteïna. Mitjançant l’ús d’inhibidors químics de les quinases més relacionades amb la
resposta a les S100, es va determinar que la via de JNK/SAPK era la responsable de la
secreció d’aquests dos factors en aquest tipus cel·lular. A més, es va poder observar que
ERK1/2 es veia també activat en resposta a la S100A7. Aquestes dues vies són també les
responsables de la secreció de la MMP9 en la cèl·lula monocítica. Tot i els resultats
obtinguts, l’estudi de la via de senyalització activada per S100A7 és d’una elevada
complexitat, per la qual cosa seria necessari realitzar estudis més profunds per determinar
amb més exactitud les vies i els factors de transcripció implicats en la seva resposta en els
diferents tipus cel·lulars.
Un fet a tenir en compte és que, tot i que, fins a la data, tan sols s’ha pogut descriure
RAGE com a possible receptor per la S100A7, és molt probable que pugui unir-se a altres
receptors (TLR4, CD36, GPCRs, etc.), com fan altres membres de la família
(S100A8/S100A9, la S100A12 i la S100A15, etc.) (Donato et al., 2013). Nosaltres hem
demostrat en aquest treball la interacció molecular de S100A7 i RAGE, confirmant que
aquest receptor estaria implicat, en part, en la mediació de la resposta a la proteïna. Tot i
això, tenint en compte que la línia THP1 (que no expressa RAGE) és capaç de respondre a
la S100A7, es demostra que la seva funció estaria regulada per més d’un receptor, depenent
del tipus cel·lular.
A banda de la funció de la S100A7 a nivell de tumor primari, es important determinar el
paper que aquesta proteïna juga en la progressió metastàtica. En aquest sentit, s’ha vist que
l’expressió de la proteïna en tumors mamaris correlaciona amb una major implantació
metastàtica en el teixit pulmonar (Emberley et al., 2003a; Krop et al., 2005). En aquest
treball ens vam plantejar la possibilitat de que la S100A7 estigués afavorint aquest procés,
no només pel seu efecte a nivell de moviment cel·lular i de formació d’un entorn
proangiogènic i proinflamatori idoni, sinó també degut a que la proteïna secretada a la sang
pogués actuar sobre els teixits distants, preparant-los per l’eventual arribada de les cèl·lules
tumorals (formació del nínxol premetastàtic). Mitjançant estudis de metàstasi experimental
188
Discussió
vam comprovar que la presència de la S100A7 a la sang dels ratolins incrementava el
nombre de cèl·lules tumorals implantades al fetge. A més, en un estudi més profund del
teixit hepàtic es va poder veure que la proteïna induïa un augment en la seva fibrotització
degut a l’entrecreuament de les fibres de col·lagen. Esta descrit que aquest fet permet
l'establiment de les BMDCs, que posteriorment prepararan un entorn idoni per a la
colonització de les cèl·lules metastàtiques (Kaplan et al., 2005). El mecanisme pel qual la
S100A7 fa incrementar la fibrosis del teixit roman encara per determinar, tot i això, alguns
indicis fan pensar que podria ser a través de l’activació dels fibroblasts residents al fetge.
Per exemple, recentment s’ha publicat un estudi en què es demostrava un efecte similar per
un altre membre de la família, la S100A4. Aquesta proteïna es troba secretada pels
macròfags en resposta a diferents estímuls i activa les cèl·lules hepàtiques estelades,
encarregades de secretar molècules de la matriu i incrementar la fibrosis del teixit (Chen et
al., 2014b).
Amb tot, el conjunt de resultats derivats de l'estudi de la funció de la S100A7 a nivell
extracel·lular en el desenvolupament tumoral ens ha permès ampliar d'una manera important
el coneixement previ de la proteïna, oferint una visió integradora del seu paper en el
microentorn del tumor. Com hem vist, després de ser secretada de manera activa o passiva
per les cèl·lules tumorals, la proteïna S100A7 té un paper clarament promigratori sobre els
diferents tipus cel·lulars amb els que hem treballat, afavorint el reclutament de les cèl·lules
immunes i el moviment de les cèl·lules tumorals, endotelials i els fibroblasts (Figura 1).
Aquest paper es veu potenciat per la secreció de diferents citoquines i factors de creixement
que formen un entorn proangiogènic i proinflamatori idoni per a la progressió de la malaltia
(Figura 2). A més, la S100A7 té un paper important contribuint a la formació d’un nínxol
premetastàtic que facilitaria la implantació de les cèl·lules tumorals.
189
S100A7
Active/Passive
release
Tumor cell
activation
Invasive carcinoma
Normal epithelium
Basement membrane
S100A7
Recruitment
Recruitmen
S100A7
CAF
Tumor cell
migration/invasion
Matrix remodeling
TAM
S100A7
S100A7
Immune system
recruitment
Differentiation
Adhesion
Angiogenesis formation
i
Tumor
biomarker
Metastatic
spread
Premetastatic
niche formation
Figura 1. Mecanisme d’acció de la proteïna S100A7 en el desenvolupament tumoral
VEGF
PLGF
GM-CSF
ANG
Endostatin
uPAR
RANTES
MMP1
Fibroblasts IL8
MCP-3
Tumor cells
S100A7
Immune cells
GM-CSF
IFNγ
GRO
PECAM-1
ENA-78
IL6
Leptin
ANGPT2
MCP-4
I-TAC
ECM
GM-CSF / MCP-3 / IL6 / ENA-78 / I-TAC /
VEGFR3 / VEGFR2 / EGF / VEGF / PDGF-BB
Endothelial cells
GRO
TNF-α
MCP-4
IL1-β
IL6
MMP9
Leptin
VEGFR2
I-309
MCP-1
Figura 2. Xarxa de comunicació activada en resposta a S100A7 en els diferents
compartiments tumoral s
190
Discussió
5.2. Prova de principi de la teràpia basada en anticossos
monoclonals contra la proteïna S100A7
Un dels principals problemes a l’hora de dissenyar una estratègia per bloquejar la
funció de les proteïnes S100 és el desconeixement que continua existint sobre el seu
mecanisme d’acció, més enllà de la descripció d’alguns possibles receptors i altres proteïnes
d’unió a nivell intracel·lular i extracel·lular. Davant d’aquestes limitacions, diferents estudis
han demostrat la importància d’aquestes proteïnes en el desenvolupament tumoral
mitjançant la inhibició complerta de la seva expressió, utilitzant models transfectats amb
shRNAs.
Per exemple, s’ha vist que l’ús d’un shRNA contra la S100A4 en cèl·lules de càncer de
pàncrees redueix de manera important el seu creixement subcutani (Hernandez et al., 2013).
D’una manera similar, la inhibició de l’expressió de la S100P redueix el creixement subcutani
de cèl·lules de càncer de còlon, així com la seva capacitat metastàtica (Jiang et al., 2011).
En els cas de la S100A7, s’ha vist que, després d’eliminar la seva expressió, les cèl·lules
tumorals de càncer de mama creixen més lentament in vivo i perden la seva capacitat
metastàtica (Krop et al., 2005; Paruchuri et al., 2008). Tot i això, l’ús d’aquesta metodologia
pot ocasionar alhora distorsió en l’expressió d’altres gens associats, de manera que l’efecte
observat pot no ser totalment específic de la diana inhibida.
Pel que fa al bloqueig funcional de les proteïnes S100, una de les estratègies
desenvolupades consisteix en l’ús de molècules químiques dirigides a inhibir la seva
interacció amb proteïnes diana conegudes. Un exemple és el Tasquinimod, una molècula
química que, entre altres mecanismes, bloqueja la unió de la S100A9 amb els seus
receptors, TLR4 i RAGE (Raymond et al., 2014) i que es troba actualment en estudis clínics
de Fase III per al tractament del mCRPC (Armstrong et al., 2014) i de Fase II per al
tractament del càncer hepatocel·lular metastàtic, del càncer d’ovari, del càncer renal i del
càncer gàstric (Active, 2014). Els resultats amb aquest fàrmac són la prova de concepte més
clara fins a la data sobre l’ús d’agents inhibidors de la funció extracel·lular de les proteïnes
S100 per al tractament del càncer. Un altre exemple és la cromolina, una molècula
antial·lèrgica que bloqueja la unió de la S100P amb el receptor RAGE i que ha demostrat ser
efectiva en models animals de càncer de pàncrees (Arumugam et al., 2006). No obstant
això, existeixen problemes relacionats amb l'especificitat d'aquests fàrmacs degut a la
similitud estructural entre les seves dianes i la resta de membres de la família, i també per la
seva unió a altres proteïnes. De fet, s’ha vist que el Tasquinimod és capaç de unir-se també
a la histona deacetilasa HDAC4, reduint la capacitat de les MDSCs per diferenciar-se a
191
macròfags (Isaacs et al., 2013), i que la cromolina pot interaccionar també amb la S100A12 i
la S100A13 (Okada et al., 2002).
Així doncs, tenint en compte que en els darrers anys ha guany at força el paper
extracel·lular de les S100 en el desenvolupament tumoral i que la seva secreció es dóna
principalment sota condicions patològiques, alguns grups, entre els quals el nostre, han
proposat el seu bloqueig funcional mitjançant anticossos monoclonals específics, com una
nova estratègia terapèutica. Aquesta estratègia ha demostrat ser efectiva per al bloqueig de
la proteïna S100A4 en models de càncer de pàncrees (Hernandez et al., 2013) i de mama
(Klingelhofer et al., 2012), i de la S100P també en models de càncer de pàncrees, mostrant,
fins i tot, una millor activitat que la cromolina (Dakhel et al., 2014). D’altra banda, també
s’han utilitzat anticossos monoclonals en models preclínics de malalties inflamatòries
demostrant una bona activitat. Per exemple, inhibidors de la S100A4 en models de psoriasis
(Zibert et al., 2010) o inhibidors de la S100A9 en models de la malaltia de crohn i d’artritis
(InflammatoRX, 2014).
Els anticossos monoclonals ofereixen una sèrie d'avantatges respecte de les
molècules químiques com són una menor eliminació, una elevada afinitat i una menor
toxicitat derivada d’unions inespecífiques (Glassman and Balthasar, 2014). Tenint en compte
aquest fet i amb l'experiència prèvia del nostre grup, es va decidir desenvolupar anticossos
monoclonals bloquejants de la proteïna S100A7 per demostrar la prova de principi d'aquesta
estratègia terapèutica.
Un cop obtinguts els anticossos específics, setze en concret, es va realitzar un
cribratge en cascada mitjançant estudis a nivell molecular, cel·lular i in vivo per tal de
seleccionar el candidat més eficaç en bloquejar la funció de la proteïna.
Està descrit que la S100A7 exerceix, almenys en part, la seva funció extracel·lular a
través del receptor RAGE (Hattinger et al., 2013). Tenint en compte aquest fet, es va
desenvolupar un assaig senzill basat en la tècnica ELISA per estudiar la interacció proteïnareceptor i realitzar l’estudi funcional a nivell molecular dels anticossos, ja que la seva
capacitat per bloquejar aquesta unió podria determinar la seva eficàcia com a eina
terapèutica. Amb aquest assaig però, tan sols vam poder identificar dos anticossos que es
trobaven clarament per sota de la resta en quant a la seva activitat inhibidora, el què
demostrava que tots ells s’unien a una regió de la proteïna que, en major o menor mesura,
intervenia en la unió de la S100A7 amb RAGE. Davant d’aquest resultat poc discriminatori i
tenint en compte que, com s’ha comentat anteriorment, és molt probable que la proteïna
tingui altres receptors, va ser necessari realitzar estudis cel·lulars on es demostrés una
192
Discussió
funció concreta de la S100A7, per seleccionar els millors candidats en base a la seva
capacitat inhibitòria.
Per a l’estudi funcional dels anticossos a nivell cel·lular, vam aprofitar aquells assaigs
on vam observar un major efecte en resposta a la proteïna S100A7. En concret, es va
seleccionar l’efecte promigratori induït sobre la línia tumoral MDA-MB-231 per estudiar
l’eficàcia dels setze anticossos inicials. Igual que passava en l’assaig d’interacció molecular
entre S100A7 i RAGE, tots els anticossos van tenir, en major o menor mesura, un efecte
inhibidor de la funció de la proteïna, tot i que sis d’ells van mostrar una major eficàcia. A
més, els dos que van mostrar una menor activitat coincidien amb els menys eficaços en
l’estudi molecular, demostrant que l’epitop reconegut per aquests dos anticossos no es troba
a la regió efectora de la proteïna. Un cop seleccionats els sis anticossos més funcionals, es
va confirmar la seva activitat bloquejant sobre l’efecte de la S100A7 en la migració d’altres
tipus cel·lulars i en la secreció de metal·loproteïnes per part de la cèl·lula endotelial,
demostrant que no només eren capaços d’inhibir la funció cel·lular de la S100A7, sinó també
la secreció de factors en resposta a la proteïna. Per tant, aquests sis anticossos es van
seleccionar per realitzar l’estudi in vivo.
A l’hora d’escollir el model tumoral on s’avaluaria l’activitat dels nostres anticossos, era
essencial escollir aquell que el seu creixement fos depenent, almenys en part, de la
presència de la S100A7. Després d’analitzar tots els models disponibles al laboratori, es va
observar expressió de la proteïna en els tumors derivats de 5 línies cel·lulars, sent la línia de
carcinoma epidermoide A431 la que va mostrar un major nivell. Aquestes cèl·lules, a més,
no expressaven la proteïna quan es trobaven en condicions de cultiu normals, suggerint així
que el seu gen estava sotmès a una regulació que depenia del context microambiental en
què es trobava la cèl·lula. De fet, durant l’estudi de l’evolució in vivo d’aquesta línia després
de ser inoculada subcutàniament, vam observar que l’inici de l’expressió de la S100A7
coincidia amb l’inici de la fase exponencial de creixement i amb una clara reducció del temps
de duplicació. Està descrit que per que el tumor pugui assolir un major volum necessita
establir una xarxa vascular que li doni suport (Hanahan and Folkman, 1996). Així doncs,
podríem pensar que la S100A7 es troba directament implicada en l’establiment de la
vasculatura en aquest model i que, per tant, el seu bloqueig podria tenir un important efecte
sobre la seva evolució.
A banda de l’estudi d’eficàcia, vam voler analitzar en més profunditat quins factors o
condicions ambientals podien estar fent que la línia tumoral A431 comencés a expressar la
S100A7, per així tenir més dades sobre la regulació d’aquesta proteïna. Quan el tumor
sobrepassa un volum determinat, es crea al seu interior un ambient hipòxic que estimula,
193
principalment per activació del factor de transcripció HIF-1α (Liang et al., 2014), l’inici de
l’expressió de diferents gens implicats en la vascularització. En els estudis realitzats en
aquest treball, hem pogut comprovar que l’activació de HIF-1α pot acabar induint l’expressió
de S100A7. Tot i que no està descrita aquesta relació, per anàlisi de la seqüència promotora
del gen de S100A7 utilitzant les matrius de la base de dades JASPAR amb una astringència
del 85%, hem predit que existeix un centre d’unió per HIF-1α amb una seqüència
CTGCGTGT (score 0.876). Per tant, és possible que es doni l’activació transcripcional de
S100A7 per aquest factor. A més, el fet de que la proteïna es trobés expressada sobretot en
la zona perinecròtica ens confirmaria que hi ha una coincidència entre la hipòxia intratumoral
i l’activació del gen.
És en aquesta zona perinecròtica on, a més, les cèl·lules tumorals reben una major
quantitat de senyals provinents de la lisi cel·lular o d’altres cèl·lules infiltrades. Prèviament,
alguns investigadors havien descrit que determinats factors podien induir l’expressió de
S100A7, com per exemple l’oncostatina M i la IL-6 en cèl·lules de càncer de mama (West
and Watson, 2010) o el TNFα en queratinòcits humans, a través de l’activació de factor de
transcripció NFκB (Hau et al., 2013). També en queratinòcits humans, s’ha observat que
l’estímul amb la combinació de IL-17A i IFN-γ, indueix l’expressió de S100A7, en aquest cas,
via l’activació del factor de transcripció STAT3 (Simanski et al., 2013). En concordança amb
aquest fet, vam comprovar que l’estímul amb TNFα estimulava l’expressió i la secreció de la
proteïna en la línia tumoral A431. En aquest punt, cal remarcar que, com hem vist, la
S100A7 indueix la secreció de TNFα en cèl·lules immunes i de IL-6 en diferents línies
cel·lulars, de manera que en el tumor es podria estar creant un loop positiu d’estimulació
entre les cèl·lules tumorals i la resta de components, que incrementés de manera
exponencial la secreció d’aquests factors.
Per últim, les cèl·lules tumorals també es troben sotmeses a una elevada densitat
cel·lular que pot afectar el patró d’expressió de proteïnes. Per exemple, està descrit que
aquestes condicions indueixen l’expressió de VEGF en cèl·lules de fibrosarcoma i de
glioblastoma a través de l’activació del protooncogen c-src (Mukhopadhyay et al., 1998). En
el cas de la A431, com a conseqüència del cultiu sota condicions d’elevada confluència es
va observar un gran increment de l’expressió i secreció de S100A7. A més, aquesta
expressió es veia limitada als cúmuls de major densitat cel·lular, en concordança amb el
patró d’expressió observat a nivell tumoral, on la S100A7 no es troba distribuïda de manera
heterogènia dins del teixit. Un altre fet a destacar és que, un cop les cèl·lules deixaven
d’estar sotmeses a aquesta elevada confluència, l’expressió de la proteïna es veia reduïda
considerablement, fet que demostra la relació directa entre les condicions ambientals i la
seva regulació. A més, està descrit que determinats tipus cel·lulars mostren una major
194
Discussió
activació de STAT3 quan es troben sotmeses a una elevada confluència (Steinman et al.,
2003), un factor de transcripció que, com hem dit anteriorment, ha estat relacionat amb la
inducció de l’expressió de S100A7 en resposta a senyals externs.
Així doncs, el conjunt de resultats derivats d’aquests estudis ens van permetre fer-nos
una idea de quins factors ambientals poden fer que les cèl·lules tumorals iniciïn l’expressió
de la proteïna S100A7 per tal d’avançar en el seu creixement.
Per a l’estudi d’eficàcia dels anticossos monoclonals en el model subcutani de la línia
A431, es van realitzar dues aproximacions: d’una banda, es va iniciar el tractament quan els
tumors van assolir un volum petit, però un cop ja mostraven expressió de la proteïna. D’altra
banda, es va iniciar el tractament en tumors ben establerts amb volums pràcticament el
doble de grans. Una tercera alternativa que es podria haver utilitzat era iniciar el tractament
abans de que els tumors expressessin la proteïna, anticipant-nos a que aquesta pogués fer
la seva funció. Tot i això, vam descartar aquesta possibilitat ja que, tenint en compte el que
passaria a la pràctica clínica, no tindria sentit donar un tractament dirigit contra una diana
que no hi sigui present, sinó que els fàrmacs han de ser capaços d’actuar sobre tumors ben
establerts on la proteïna a bloquejar ja hi és present fent la seva funció.
A més, es va seleccionar una via d’administració (intraperitoneal), una dosi (500 μg) i
una pauta (tres cops per setmana) que, en estudis realitzats pel nostre grup, havia mostrat
ser suficient per veure l’eficàcia d’anticossos anti-S100A4 en un model de creixement
subcutani de càncer pàncrees (Hernandez et al., 2013). No obstant, la vasculatura pot ser
molt diferent en cada model, afectant directament a l’arribada dels fàrmacs al tumor, de
manera que vam confirmar, mitjançant diferents anàlisis, que els anticossos administrats
eren capaços d’arribar a la massa tumoral de la A431.
Com a resultat dels estudis d’eficàcia plantejats, vam demostrar per primer cop que el
bloqueig extracel·lular de la proteïna S100A7 amb anticossos monoclonals era capaç de
reduir el creixement tumoral de manera significativa. En aquest cas, l’anticòs 6F5 va ser el
que va mostrar un major efecte. A més, els anticossos 8B6 i 9F3 també van mostrar una
reducció important del volum tumoral al llarg de l’estudi. En canvi, el 6E3 i el 2D9 van tenir
un efecte molt modest i el 2H3 pràcticament no va afectar l’evolució dels tumors. D’aquesta
manera, es demostra que, tot i que a nivell cel·lular els sis anticossos semblaven bones
eines per bloquejar l’efecte induït per S100A7, l’estudi in vivo és imprescindible per a la
selecció del candidat final, ja que és en aquest context on l’anticòs ha de complir unes
característiques que li permetin arribar al tumor, difondre correctament dins del teixit, i
bloquejar amb la major eficàcia la proteïna extracel·lular. De fet, tot i que els models in vitro
han millorat molt en els darrers anys i els estudis de cocultiu són utilitzats habitualment, és
195
pràcticament impossible reproduir al laboratori la gran multitud de processos i
esdeveniments que succeeixen alhora en un tumor. Aquesta dificultat és encara més
pronunciada quan volem estudiar l’efecte del bloqueig d’una proteïna com la S100A7, que és
capaç d’interactuar a la vegada amb diferents cèl·lules i components del microentorn
tumoral.
El motiu pel qual l’eficàcia de l’anticòs 6F5 in vivo va ser millor que la resta, mentre
que, a jutjar pels resultats a nivell cel·lular, haurien d’haver estat tots molt més propers
funcionalment, roman encara per determinar. Una possible explicació és que, en els estudis
in vitro, la S100A7 es trobaria completament bloquejada degut a que s’utilitzava un excés
d’anticòs respecte de la quantitat de proteïna i, a més, es preincubaven les dues molècules
abans d’afegir-les a les cèl·lules, concedint un temps d’avantatge a l’anticòs per que pogués
actuar. En aquestes condicions, tots els anticossos estarien funcionant al màxim de la seva
capacitat, independentment de la seva afinitat per la proteïna, de manera que el que
determinaria la seva funcionalitat seria, principalment, l’epitop que reconeixen. Aquesta
aproximació ens va permetre eliminar aquells anticossos realment poc funcionals.
En relació a aquest fet, en l’assaig d’interacció S100A7-RAGE vam veure que només
els anticossos 2G8 i 1E1 eren clarament pitjors que la resta en el bloqueig d ’aquesta unió.
Precisament, resultats preliminars sobre l’estudi dels epítops dels anticossos van mostrar
que el 2G8 s’unia a una regió propera a l’extrem N-terminal de la S100A7, que, en
l’estructura tridimensional, es troba molt allunyada de la zona d’interacció amb altres
proteïnes. Per això, aquests dos anticossos van ser els menys funcionals en els estudis in
vitro, mentre que la resta van tenir un efecte similar, destacant els sis que finalment vam
seleccionar, fet que ens fa pensar que tenen un epítop més proper a la zona efectora de la
proteïna.
No obstant, podem dir que els sis anticossos escollits no tenen el mateix epítop, com
hem pogut comprovar en els estudis de competició per formar el sandwich ELISA. En
aquests estudis, vam veure que l’anticòs 9F3 era capaç de formar una bona parella amb la
resta d’anticossos, de manera que seria el que té un epítop més distant. En canvi el 2D9, el
6E3, el 6F5 i el 8B6 semblen tenir un epítop més proper entre si, tot i que no totalment
solapat. Per últim, l’epitop del 2H3 també es trobaria proper al d’aquest grup d’anticossos,
tot i que el seu reconeixement sembla dependre, en part, de la conformació de la proteïna, ja
que va ser el pitjor en el reconeixement de la S100A7 per western blot i no va ser capaç de
detectar la proteïna per IHC.
Així doncs, podem dir que l’anticòs 6F5 és el més eficaç bloquejant la S100A7 in vivo,
no només per tenir un epítop que li permet bloquejar la interacció amb altres proteïnes, sinó
196
Discussió
també per que, segurament, té unes millors característiques farmacodinàmiques que la
resta.
Amb l’objectiu d’aprofundir en l’efecte del tractament sobre el creixement tumoral es va
realitzar un anàlisi de la vasculatura i la necrosis dels tumors del grup tractat amb l’anticòs
6F5 i del grup tractat amb el vehicle (control). Com a resultat, vam observar una important
reducció de l’àrea ocupada per vasos i de la densitat microvascular, a més d’un augment de
l’àrea necròtica. Aquest fet confirma que la proteïna S100A7 té un paper central en
l’angiogènesi, coincidint amb els nostres resultats a nivell cel·lular i amb les dades
bibliogràfiques que apuntaven a que una sobreexpressió de la proteïna correlacionava amb
una major vasculatura intratumoral (Nasser et al., 2012). A més, tenint en compte que la
proteïna participa activament en el reclutament de cèl·lules immunes cap al tumor, seria de
gran interès comprovar si després del tractament amb l’anticòs 6F5 hi ha hagut un descens,
per exemple, en el nombre de macròfags infiltrats al teixit.
Per tant, el conjunt de resultats derivats d’aquesta part del treball demostren per primer
cop la prova de principi de l’ús d’anticossos monoclonals contra la proteïna S100A7 per al
tractament del càncer, confirmant que aquesta proteïna és una bona diana terapèutica.
Tot i haver demostrat l’eficàcia de la monoteràpia dirigida contra la S100A7, s’ha de
tenir en compte que les anomenades targeted therapies tenen algunes limitacions degut a
que la seva efectivitat depèn de l’acció d’una única diana. Aquesta proteïna pot adquirir
mutacions que facin que el fàrmac deixi de ser eficient en el seu bloqueig, o bé el tumor pot
trobar vies alternatives que assumeixin les funcions de la diana bloquejada, de manera que
deixi de ser necessària per a la progressió de la malaltia (Scott et al., 2012). Per evitar o
retardar l’aparició d’aquests mecanismes de resistències, la combinació de diferents fàrmacs
contra la mateixa via o de les teràpies dirigides amb els quimioterapèutics ha demostrat ser
una millor alternativa per al tractament del càncer.
En aquest sentit, un camp per explorar és la relació que existeix entre la S100A7 i el
EGF. S’ha vist que la presència de la proteïna augmenta la capacitat de respondre al factor
de creixement de les cèl·lules tumorals (Sneh et al., 2013). Aquest fet fa pensar que el
bloqueig de la S100A7 en combinació amb agents inhibidors de la via d’EGF (Cetuximab,
Erlotinib, etc.) podria ser una bona estratègia per incrementar l’efectivitat derivada dels
tractaments estàndards.
197
5.3. La proteïna S100A7 com a biomarcador de diagnòstic tumoral
Els tumors alliberen una gran quantitat de proteïnes i vesícules que es distribueixen a
nivell sistèmic via torrent sanguini o limfàtic i que poden ser excretats, per exemple, a través
de l’orina o la saliva. Aquesta secreció es pot donar de manera activa o passiva (per lisi
cel·lular), i ha estat aprofitada per la detecció no invasiva de marcadors específics que
permeten diagnosticar la malaltia, fer un seguiment de l’evolució del tumor i la seva resposta
al tractament o bé detectar l’aparició de recurrències després de la resecció quirúrgica. Tot i
això, existeixen patologies no canceroses que provoquen l’increment d’alguns marcadors
comuns a diferents tipus de tumors, com per exemple la AFP en malalties hepàtiques o la β2-microglobulina en malalties renals (Duffy, 2013a). A més, molts marcadors es poden trobar
presents en els biofluids en absència de malaltia. Així doncs, la combinació de diferents
marcadors permet realitzar un diagnòstic més acurat del pacient, junt amb altres anàlisis
com el test d’imatge o l’exploració física.
En el cas de les proteïnes S100, la seva capacitat de ser secretades a l’espai
extracel·lular junt amb la seva sobreexpressió en condicions patològiques com el càncer o
les malalties inflamatòries, ha fet que diferents grups investigadors s’interessessin pel seu ús
com a possibles biomarcadors. El membre més estudiat en aquest sentit és la S100B, que
es troba en elevades quantitats a la sang de pacients amb melanoma i amb càncer de
mama. A més, aquesta proteïna també està sent estudiada com a biomarcador en desordres
neurològics com l’alzheimer (Chaves et al., 2010) o el dany cerebral (Goyal et al., 2013). La
S100A4 també s’ha postulat com a marcador trobant-se elevada en el líquid sinovial de
pacients amb artritis reumatoide (Klingelhofer et al., 2007) i a la sang de pacients amb
càncer renal, correlacionant amb el seu potencial metastàtic (Yang et al., 2012). A més, la
S100A6, la S100A8/A9 o la S100P també han estat estudiats com a possibles biomarcadors
en càncer.
La proteïna S100A7 s’ha trobat sobreexpressada en tumors de diferents teixits, com
pulmó, mama, pell, bufeta, cap i coll, laringe, esòfag, estómac i ovari, correlacionant amb un
mal pronòstic per al pacient. Alguns investigadors han estudiat la possible implicació de la
proteïna com a biomarcador en fluids derivats de malalts de càncer, trobant una relació
positiva entre la presència del tumor i els nivells de proteïna, per exemple, en sang de
malalts de càncer de pulmó (Zhang et al., 2008) o en orina de pacients de càncer de bufeta
(Ostergaard et al., 1999) i de melanoma (Brouard et al., 2002). A més, en altres malalties
com la psoriasis o l’Alzheimer també s’ha trobat una major quantitat de S100A7 en sang
(Anderson et al., 2009) i en líquid cefaloraquidi (Qin et al., 2009), respectivament.
198
Discussió
Aquesta possible utilitat de la proteïna com a biomarcador tumoral, ens va portar a
desenvolupar un kit propi, basat en un sandwich ELISA, per a la seva quantificació,
aprofitant els anticossos monoclonals obtinguts al laboratori. Amb aquest sistema, vam
poder valorar la presència de la S100A7 en sang de models animals i determinar la seva
secreció per part de diferents línies tumorals a nivell cel·lular.
En el model de creixement tumoral de la línia de carcinoma epidermoide A431, es va
observar una correlació positiva entre la presència de la proteïna en sèrum i el volum dels
tumors. A més, existia una diferència estadísticament significativa entre els nivells de
S100A7 en presència de tumor i en absència d’aquest. Aquestes dades donen suport als
resultats obtinguts per altres grups a nivell clínic. A més, el fet que la proteïna es pugui
trobar a la sang confirma que està sent alliberada pel tumor i que, per tant, pot estar tenint
una funció al microentorn tumoral, tal com s’ha discutit anteriorment.
D’altra banda, vam voler estudiar de manera preliminar la presència de la proteïna a la
sang després d’extirpar el tumor. Com s’ha dit anteriorment, alguns biomarcadors tumorals
es fan servir per comprovar la complerta resecció de la massa tumoral després de la
intervenció quirúrgica i per la detecció precoç de recidives en pacients aparentment curats.
Per això, és important que existeixi una relació directa entre els nivells del marcador en el
biofluid i la presència de tumor, i que, un cop extirpat, la concentració del marcador torni
ràpidament a nivells normals. Per exemple, en el cas del PSA, la seva vida mitja en sang és
de 2-3 dies, de manera que la persistència d’uns nivells elevats a la setmana d’eliminar el
tumor de pròstata significaria que hi ha persistència de teixit maligne (Poyet et al., 2012). En
els nostres estudis en models animals, vam poder comprovar que als tres dies d’extirpar els
tumors, els nivells sanguinis de S100A7 havien caigut completament fins a nivells basals. De
fet, s’ha determinat que un altre membre de la fam ília, la S100B, té una vida mitja en sang
de només 30 minuts (Ghanem et al., 2001), fet que demostra que aquestes proteïnes són
fàcil i ràpidament eliminades de la sang un cop s’elimina la font d’origen. Així doncs, la
S100A7 podria ser d’interès per detectar si la resecció quirúrgica ha estat complerta i si hi ha
aparició de recidives (monitorització).
Amb tot, els estudis en models animals realitzats en aquest treball han afegit noves
dades sobre el comportament de la proteïna S100A7 com a marcador tumoral en sang i, a
més, ens ha permès validar el nostre sistema de sandwich ELISA com un mètode
suficientment sensible per poder realitzar estudis més complexes amb mostres derivades de
pacients amb càncer. Aquests estudis ens permetran comprovar l’especificitat de la proteïna
S100A7 com a biomarcador i valorar la seva possible relació amb l’estadiatge de la malaltia,
sense oblidar la seva possible importància en estudis de resposta al tractament. A més,
199
podríem estudiar si la detecció de S100A7 junt amb altres biomarcadors utilitzats actualment
a la clínica permet un diagnòstic més acurat del pacient o una millor previsió de la seva
evolució.
200
Conclusions
201
Conclusions
6. CONCLUSIONS
1.
A nivell extracel·lular, la proteïna S100A7 té un efecte inductor sobre la migració de la
cèl·lula endotelial, immune, fibroblàstica i tumoral. No té un efecte apreciable sobre la
seva capacitat proliferativa, actua com a molècula d’adhesió en la línia endotelial
HUVEC i el fibroblast BJ, i augmenta l’adhesió dels monòcits sobre l’endoteli.
2.
La proteïna S100A7 indueix un canvi en el patró de secreció de citoquines depenent del
tipus cel·lular. A la cèl·lula tumoral alguns dels factors més significatius són el GM-CSF,
el GRO i l‘ENA-78, a la cèl·lula immune el GRO, el TNFα i la MMP9, al fibroblast el GMCSF, el VEGF i l’angiopoietina, i a la cèl·lula endotelial el GM-CSF, la IL6 i el I-TAC. La
creació d’aquest microambient proangiogènic i proinflamatori contribueix, junt amb la
pròpia S100A7, a la formació vascular, al reclutament de cèl·lules immunes i a
incrementar la capacitat invasiva de les cèl·lules tumorals.
3.
S100A7 indueix una resposta sobre la cèl·lula endotelial i el monòcit, principalment a
través de l’activació de les quinases ERK1/2 i JNK.
4.
La proteïna S100A7 participa en la formació del nínxol premetastàtic tot incrementant la
fibrosi hepàtica i, en conseqüència, afavorint la colonització de la cèl·lula tumoral.
5.
L’expressió de la proteïna S100A7 a la cèl·lula tumoral es veu regulada per diferents
condicions microambientals, com són la hipòxia, la presència de factors solubles com el
TNFα o l’elevada densitat cel·lular.
6.
Existeix una correlació positiva entre la presència de S100A7 al sèrum i el volum
tumoral en un model subcutani de la línia A431.
7.
S’han generat anticossos monoclonals específics contra la proteïna S100A7 útils com a
eines de recerca per diferents tècniques de biologia molecular ( western blot,
immunocitoquímica, immunohistoquímica i ELISA).
8.
S’han seleccionat sis anticossos monoclonals (2D9, 2H3, 6E3, 6F5, 8B6 i 9F3) capaços
d’inhibir la interacció de la S100A7 amb el receptor de membrana RAGE, l’efecte
promigratori induït per la proteïna sobre diferents tipus cel·lulars (tumoral, endotelial,
immune i fibroblast), i la secreció de metal·loproteïnases de la matriu en resposta a la
S100A7 per part de la cèl·lula endotelial.
203
9.
La inhibició de la funció extracel·lular de la proteïna S100A7 mitjançant l’ús d’anticossos
monoclonals en un model subcutani de la línia de carcinoma epidermoide A431,
provoca un descens estadísticament significatiu en el creixement tumoral, redueix
l’angiogènesi i augmenta la necrosi del teixit, sent l’anticòs 6F5 el candidat escollit per
avançar en el desenvolupament preclínic.
10. La teràpia antitumoral dirigida al bloqueig extracel·lular de la proteïna S100A7
mitjançant anticossos monoclonals es proposa com una nova i eficient estratègia
terapèutica per al tractament del càncer.
204
Bib liografia
205
Bib liografia
7. BIBLIOGRAFIA
A
Abhinandan, K. R., and Martin, A. C. (2008). Analysis and improvements to Kabat and
structurally correct numbering of antibody variable domains. Molecular immunology 45,
3832-3839.
Aboussekhra, A. (2011). Role of cancer-associated fibroblasts in breast cancer development
and prognosis. The International journal of developmental biology 55, 841-849.
Active (2014). Tasquinimod. In, (Active Biotech).
Adelstein, B. A., Dobbins, T. A., Harris, C. A., Marschner, I. C., and Ward, R. L. (2011). A
systematic review and meta-analysis of KRAS status as the determinant of response to antiEGFR antibodies and the impact of partner chemotherapy in metastatic colorectal cancer.
European journal of cancer 47, 1343-1354.
Aggarwal, B. B., Vijayalekshmi, R. V., and Sung, B. (2009). Targeting inflammatory pathways
for prevention and therapy of cancer: short-term friend, long-term foe. Clinical cancer
research : an official journal of the American Association for Cancer Research 15, 425-430.
Al-Haddad, S., Zhang, Z., Leygue, E., Snell, L., Huang, A., Niu, Y., Hiller-Hitchcock, T., Hole,
K., Murphy, L. C., and Watson, P. H. (1999). Psoriasin (S100A7) expression and invasive
breast cancer. The American journal of pathology 155, 2057-2066.
Alameddine, R. S., Hamieh, L., and Shamseddine, A. (2014). From Sprouting Angiogenesis
to Erythrocytes Generation by Cancer Stem Cells: Evolving Concepts in Tumor
Microcirculation. BioMed research international 2014, 986768.
Alawadi, S., Ghabreau, L., Alsaleh, M., Abdulaziz, Z., Rafeek, M., Akil, N., and Alkhalaf, M.
(2011). P53 gene polymorphisms and breast cancer risk in Arab women. Medical oncology
28, 709-715.
Ambartsumian, N., Klingelhofer, J., Grigorian, M., Christensen, C., Kriajevska, M.,
Tulchinsky, E., Georgiev, G., Berezin, V., Bock, E., Rygaard, J., et al. (2001). The
metastasis-associated Mts1(S100A4) protein could act as an angiogenic factor. Oncogene
20, 4685-4695.
Anderson, K. S., Wong, J., Polyak, K., Aronzon, D., and Enerback, C. (2009). Detection of
psoriasin/S100A7 in the sera of patients with psoriasis. The British journal of dermatology
160, 325-332.
Andreakos, E., Sacre, S. M., Smith, C., Lundberg, A., Kiriakidis, S., Stonehouse, T., Monaco,
C., Feldmann, M., and Foxwell, B. M. (2004). Distinct pathways of LPS-induced NF-kappa B
activation and cytokine production in human myeloid and nonmyeloid cells defined by
selective utilization of MyD88 and Mal/TIRAP. Blood 103, 2229-2237.
Armstrong, A. J., Kaboteh, R., Carducci, M. A., Damber, J. E., Stadler, W. M., Hansen, M.,
Edenbrandt, L., Forsberg, G., Nordle, O., Pili, R., and Morris, M. J. (2014). Assessment of
the bone scan index in a randomized placebo-controlled trial of tasquinimod in men with
metastatic castration-resistant prostate cancer (mCRPC). Urologic oncology.
207
Arumugam, T., Ramachandran, V., Gomez, S. B., Schmidt, A. M., and Logsdon, C. D.
(2012). S100P-derived RAGE antagonistic peptide reduces tumor growth and metastasis.
Clinical cancer research : an official journal of the American Association for Cancer Research
18, 4356-4364.
Arumugam, T., Ramachandran, V., and Logsdon, C. D. (2006). Effect of cromolyn on S100P
interactions with RAGE and pancreatic cancer growth and invasion in mouse models.
Journal of the National Cancer Institute 98, 1806-1818.
Arumugam, T., Simeone, D. M., Van Golen, K., and Logsdon, C. D. (2005). S100P promotes
pancreatic cancer growth, survival, and invasion. Clinical cancer research : an official journal
of the American Association for Cancer Research 11, 5356-5364.
Asahara, T., Bauters, C., Zheng, L. P., Takeshita, S., Bunting, S., Ferrara, N., Symes, J. F.,
and Isner, J. M. (1995). Synergistic effect of vascular endothelial growth factor and basic
fibroblast growth factor on angiogenesis in vivo. Circulation 92, II365-371.
Asahara, T., Masuda, H., Takahashi, T., Kalka, C., Pastore, C., Silver, M., Kearne, M.,
Magner, M., and Isner, J. M. (1999). Bone marrow origin of endothelial progenitor cells
responsible for postnatal vasculogenesis in physiological and pathological
neovascularization. Circulation research 85, 221-228.
Astrand, R., Unden, J., and Romner, B. (2013). Clinical use of the calcium -binding S100B
protein. Methods in molecular biology 963, 373-384.
Atlasi, Y., Looijenga, L., and Fodde, R. (2014). Cancer stem cells, pluripotency, and cellular
heterogeneity: a WNTer perspective. Current topics in developmental biology 107, 373-404.
B
Balkwill, F. (2006). TNF-alpha in promotion and progression of cancer. Cancer metastasis
reviews 25, 409-416.
Balliet, R. M., Capparelli, C., Guido, C., Pestell, T. G., Martinez-Outschoorn, U. E., Lin, Z.,
Whitaker-Menezes, D., Chiavarina, B., Pestell, R. G., Howell, A., et al. (2011). Mitochondrial
oxidative stress in cancer-associated fibroblasts drives lactate production, promoting breast
cancer tumor growth: understanding the aging and cancer connection. Cell cycle 10, 40654073.
Bannatyne, R. M., Harnett, N. M., Lee, K. Y., and Biggar, W. D. (1977). Inhibition of the
biologic effects of endotoxin on neutrophils by polymyxin B sulfate. The Journal of infectious
diseases 136, 469-474.
Barnes, J. M., Nauseef, J. T., and Henry, M. D. (2012). Resistance to fluid shear stress is a
conserved biophysical property of malignant cells. PloS one 7, e50973.
Bastos, D. A., Dzik, C., Rathkopf, D., and Scher, H. I. (2014). Expanding androgen- and
androgen receptor signaling-directed therapies for castration-resistant prostate cancer.
Oncology (Williston Park) 28, 693-699.
Basu, G. D., Azorsa, D. O., Kiefer, J. A., Rojas, A. M., Tuzmen, S., Barrett, M. T., Trent, J.
M., Kallioniemi, O., and Mousses, S. (2008). Functional evidence implicating S100P in
prostate cancer progression. International journal of cancer Journal international du cancer
123, 330-339.
208
Bib liografia
Baudier, J., and Gerard, D. (1986). Ions binding to S100 proteins. II. Conformational studies
and calcium-induced conformational changes in S100 alpha alpha protein: the effect of acidic
pH and calcium incubation on subunit exchange in S100a (alpha beta) protein. The Journal
of biological chemistry 261, 8204-8212.
Baxevanis, C. N., Perez, S. A., and Papamichail, M. (2009). Combinatorial treatments
including vaccines, chemotherapy and monoclonal antibodies for cancer therapy. Cancer
immunology, immunotherapy : CII 58, 317-324.
Beenken, A., and Mohammadi, M. (2009). The FGF family: biology, pathophysiology and
therapy. Nature reviews Drug discovery 8, 235-253.
Begley, S. (2008). Rethinking the War on Cancer In Newsweek, (US).
Bello, D. M., Ariyan, C. E., and Carvajal, R. D. (2013). Melanoma mutagenesis and aberrant
cell signaling. Cancer control : journal of the Moffitt Cancer Center 20, 261-281.
Ben-David, U. (2014). Genomic instability, driver genes and cell selection: Projections from
cancer to stem cells. Biochimica et biophysica acta.
Bender, B., Leipold, D. D., Xu, K., Shen, B. Q., Tibbitts, J., and Friberg, L. E. (2014). A
mechanistic pharmacokinetic model elucidating the disposition of trastuzumab emtansine (TDM1), an antibody-drug conjugate (ADC) for treatment of metastatic breast cancer. The
AAPS journal 16, 994-1008.
Benoit, S., Toksoy, A., Ahlmann, M., Schmidt, M., Sunderkotter, C., Foell, D., Pasparakis, M.,
Roth, J., and Goebeler, M. (2006). Elevated serum levels of calcium-binding S100 proteins
A8 and A9 reflect disease activity and abnormal differentiation of keratinocytes in psoriasis.
The British journal of dermatology 155, 62-66.
Bettum, I. J., Vasiliauskaite, K., Nygaard, V., Clancy, T., Pettersen, S. J., Tenstad, E.,
Maelandsmo, G. M., and Prasmickaite, L. (2014). Metastasis-associated protein S100A4
induces a network of inflammatory cytokines that activate stromal cells to acquire protumorigenic properties. Cancer letters 344, 28-39.
Bighin, C., Pronzato, P., and Del Mastro, L. (2013). Trastuzumab emtansine in the treatment
of HER-2-positive metastatic breast cancer patients. Future oncology 9, 955-957.
Bjornland, K., Winberg, J. O., Odegaard, O. T., Hovig, E., Loennechen, T., Aasen, A. O.,
Fodstad, O., and Maelandsmo, G. M. (1999). S100A4 involvement in metastasis:
deregulation of matrix metalloproteinases and tissue inhibitors of matrix metalloproteinases
in osteosarcoma cells transfected with an anti-S100A4 ribozyme. Cancer research 59, 47024708.
Blank, C. U., and Enk, A. (2014). Therapeutic use of anti-CTLA-4 antibodies. International
immunology.
Bondar, T., and Medzhitov, R. (2013). The origins of tumor-promoting inflammation. Cancer
cell 24, 143-144.
Bonfil, R. D., Chinni, S., Fridman, R., Kim, H. R., and Cher, M. L. (2007). Proteases, growth
factors, chemokines, and the microenvironment in prostate cancer bone metastasis. Urologic
oncology 25, 407-411.
Bornstein, P. (2009). Thrombospondins function as regulators of angiogenesis. Journal of
cell communication and signaling 3, 189-200.
209
Boulianne, G. L., Hozumi, N., and Shulman, M. J. (1984). Production of functional chimaeric
mouse/human antibody. Nature 312, 643-646.
Bourd-Boittin, K., Fridman, R., Fanchon, S., Septier, D., Goldberg, M., and Menashi, S.
(2005). Matrix metalloproteinase inhibition impairs the processing, formation and
mineralization of dental tissues during mouse molar development. Experimental cell research
304, 493-505.
Boye, K., and Maelandsmo, G. M. (2010). S100A4 and metastasis: a small actor playing
many roles. The American journal of pathology 176, 528-535.
Boyle, P. (2012). Triple-negative breast cancer: epidemiological considerations and
recommendations. Annals of oncology : official journal of the European Society for Medical
Oncology / ESMO 23 Suppl 6, vi7-12.
Brabek, J., Mierke, C. T., Rosel, D., Vesely, P., and Fabry, B. (2010). The role of the tissue
microenvironment in the regulation of cancer cell motility and invasion. Cell communication
and signaling : CCS 8, 22.
Bravo-Cordero, J. J., Hodgson, L., and Condeelis, J. (2012). Directed cell invasion and
migration during metastasis. Current opinion in cell biology 24, 277-283.
Brekke, O. H., and Sandlie, I. (2003). Therapeutic antibodies for human diseases at the
dawn of the twenty-first century. Nature reviews Drug discovery 2, 52-62.
Brew, K., and Nagase, H. (2010). The tissue inhibitors of metalloproteinases (TIMPs): an
ancient family with structural and functional diversity. Biochimica et biophysica acta 1803, 5571.
Brodersen, D. E., Nyborg, J., and Kjeldgaard, M. (1999). Zinc-binding site of an S100 protein
revealed. Two crystal structures of Ca2+-bound human psoriasin (S100A7) in the Zn2+loaded and Zn2+-free states. Biochemistry 38, 1695-1704.
Brouard, M. C., Saurat, J. H., Ghanem, G., and Siegenthaler, G. (2002). Urinary excretion of
epidermal-type fatty acid-binding protein and S100A7 protein in patients with cutaneous
melanoma. Melanoma research 12, 627-631.
Browne, B. C., O'Brien, N., Duffy, M. J., Crown, J., and O'Donovan, N. (2009). HER-2
signaling and inhibition in breast cancer. Current cancer drug targets 9, 419-438.
Bulk, E., Sargin, B., Krug, U., Hascher, A., Jun, Y., Knop, M., Kerkhoff, C., Gerke, V.,
Liersch, R., Mesters, R. M., et al. (2009). S100A2 induces metastasis in non-small cell lung
cancer. Clinical cancer research : an official journal of the American Association for Cancer
Research 15, 22-29.
C
Cagle, P. T., Allen, T. C., and Olsen, R. J. (2013). Lung cancer biomarkers: present status
and future developments. Archives of pathology & laboratory medicine 137, 1191-1198.
Cardoso, L. S., Araujo, M. I., Goes, A. M., Pacifico, L. G., Oliveira, R. R., and Oliveira, S. C.
(2007). Polymyxin B as inhibitor of LPS contamination of Schistosoma mansoni recombinant
proteins in human cytokine analysis. Microbial cell factories 6, 1.
210
Bib liografia
Carroll, W. L., Mendel, E., and Levy, S. (1988). Hybridoma fusion cell lines contain an
aberrant kappa transcript. Molecular immunology 25, 991-995.
Cavalier, M. C., Pierce, A. D., Wilder, P. T., Alasady, M. J., Hartman, K. G., Neau, D. B.,
Foley, T. L., Jadhav, A., Maloney, D. J., Simeonov, A., et al. (2014). Covalent small molecule
inhibitors of Ca-bound S100B. Biochemistry.
Cecil, D. L., Appleton, C. T., Polewski, M. D., Mort, J. S., Schmidt, A. M., Bendele, A., Beier,
F., and Terkeltaub, R. (2009). The pattern recognition receptor CD36 is a chondrocyte
hypertrophy marker associated with suppression of catabolic responses and promotion of
repair responses to inflammatory stimuli. Journal of immunology 182, 5024-5031.
Celis, J. E., Rasmussen, H. H., Vorum, H., Madsen, P., Honore, B., Wolf, H., and Orntoft, T.
F. (1996). Bladder squamous cell carcinomas express psoriasin and externalize it to the
urine. The Journal of urology 155, 2105-2112.
Clapp, C., Gonzalez, C., Macotela, Y., Aranda, J., Rivera, J. C., Garcia, C., Guzman, J.,
Zamorano, M., Vega, C., Martin, C., et al. (2006). Vasoinhibins: a family of N-terminal
prolactin fragments that inhibit angiogenesis and vascular function. Frontiers of hormone
research 35, 64-73.
Cobb, L. (2013). Cell Based Assays: the Cell Cycle, Cell Proliferation and Cell Death.
MATER METHODS 3; 172.
Cojoc, M., Mabert, K., Muders, M. H., and Dubrovska, A. (2014). A role for cancer stem cells
in therapy resistance: Cellular and molecular mechanisms. Seminars in cancer biology.
Cole, S. P. (1986). Rapid chemosensitivity testing of human lung tumor cells using the MTT
assay. Cancer chemotherapy and pharmacology 17, 259-263.
Coleman, R. (2011). Picrosirius red staining revisited. Acta histochemica 113, 231-233.
Coleman, S. J., Bruce, C., Chioni, A. M., Kocher, H. M., and Grose, R. P. (2014). The ins and
outs of fibroblast growth factor receptor signalling. Clinical science 127, 217-231.
Collins, D. M., O'Donovan, N., McGowan, P. M., O'Sullivan, F., Duffy, M. J., and Crown, J.
(2012). Trastuzumab induces antibody-dependent cell-mediated cytotoxicity (ADCC) in HER2-non-amplified breast cancer cell lines. Annals of oncology : official journal of the European
Society for Medical Oncology / ESMO 23, 1788-1795.
Cox, T. R., Bird, D., Baker, A. M., Barker, H. E., Ho, M. W., Lang, G., and Erler, J. T. (2013).
LOX-mediated collagen crosslinking is responsible for fibrosis-enhanced metastasis. Cancer
research 73, 1721-1732.
Cross, S. S., Hamdy, F. C., Deloulme, J. C., and Rehman, I. (2005). Expression of S100
proteins in normal human tissues and common cancers using tissue microarrays: S100A6,
S100A8, S100A9 and S100A11 are all overexpressed in common cancers. Histopathology
46, 256-269.
Cuzick, J., Thorat, M. A., Andriole, G., Brawley, O. W., Brown, P. H., Culig, Z., Eeles, R. A.,
Ford, L. G., Hamdy, F. C., Holmberg, L., et al. (2014). Prevention and early detection of
prostate cancer. The Lancet Oncology 15, e484-e492.
Chang, J., and Erler, J. (2014). Hypoxia-mediated metastasis. Advances in experimental
medicine and biology 772, 55-81.
211
Chanmee, T., Ontong, P., Konno, K., and Itano, N. (2014). Tumor-associated macrophages
as major players in the tumor microenvironment. Cancers 6, 1670-1690.
Chaves, M. L., Camozzato, A. L., Ferreira, E. D., Piazenski, I., Kochhann, R., Dall'Igna, O.,
Mazzini, G. S., Souza, D. O., and Portela, L. V. (2010). Serum levels of S100B and NSE
proteins in Alzheimer's disease patients. Journal of neuroinflammation 7, 6.
Chen, H., Xu, C., Jin, Q., and Liu, Z. (2014a). S100 protein family in human cancer.
American journal of cancer research 4, 89-115.
Chen, L., Li, J., Zhang, J., Dai, C., Liu, X., Wang, J., Gao, Z., Guo, H., Wang, R., Lu, S., et al.
(2014b). S100A4 promotes liver fibrosis via activation of hepatic stellate cells. Journal of
hepatology.
Chen, Q., Jin, M., Yang, F., Zhu, J., Xiao, Q., and Zhang, L. (2013). Matrix
metalloproteinases: inflammatory regulators of cell behaviors in vascular formation and
remodeling. Mediators of inflammation 2013, 928315.
Cheng, X., and Chen, H. (2014). Tumor heterogeneity and resistance to EGFR-targeted
therapy in advanced nonsmall cell lung cancer: challenges and perspectives. OncoTargets
and therapy 7, 1689-1704.
Cherng, S., Young, J., and Ma, H. (2008). Alpha-Smooth Muscle Actin (α-SMA) The Journal
of American Science 4.
Chimal-Ramirez, G. K., Espinoza-Sanchez, N. A., and Fuentes-Panana, E. M. (2013).
Protumor activities of the immune response: insights in the mechanisms of immunological
shift, oncotraining, and oncopromotion. Journal of oncology 2013, 835956.
Chu, J. E., and Allan, A. L. (2012). The Role of Cancer Stem Cells in the Organ Tropism of
Breast Cancer Metastasis: A Mechanistic Balance between the "Seed" and the "Soil"?
International journal of breast cancer 2012, 209748.
D
Dakhel, S., Padilla, L., Adan, J., Masa, M., Martinez, J. M., Roque, L., Coll, T., Hervas, R.,
Calvis, C., Messeguer, R., et al. (2014). S100P antibody-mediated therapy as a new
promising strategy for the treatment of pancreatic cancer. Oncogenesis 3, e92.
Dallaglio, K., Marconi, A., Truzzi, F., Lotti, R., Palazzo, E., Petrachi, T., Saltari, A., Coppini,
M., and Pincelli, C. (2013). E-FABP induces differentiation in normal human keratinocytes
and modulates the differentiation process in psoriatic keratinocytes in vitro. Experimental
dermatology 22, 255-261.
Davis, S. L., Eckhardt, S. G., Tentler, J. J., and Diamond, J. R. (2014). Triple-negative breast
cancer: bridging the gap from cancer genomics to predictive biomarkers. Therapeutic
advances in medical oncology 6, 88-100.
de Azambuja, E., Holmes, A. P., Piccart-Gebhart, M., Holmes, E., Di Cosimo, S., Swaby, R.
F., Untch, M., Jackisch, C., Lang, I., Smith, I., et al. (2014). Lapatinib with trastuzumab for
HER2-positive early breast cancer (NeoALTTO): survival outcomes of a randomised, openlabel, multicentre, phase 3 trial and their association with pathological complete response.
The Lancet Oncology 15, 1137-1146.
212
Bib liografia
di Tomaso, E., Capen, D., Haskell, A., Hart, J., Logie, J. J., Jain, R. K., McDonald, D. M.,
Jones, R., and Munn, L. L. (2005). Mosaic tumor vessels: cellular basis and ultrastructure of
focal regions lacking endothelial cell markers. Cancer research 65, 5740-5749.
Diamandis, E. P. (2012). The failure of protein cancer biomarkers to reach the clinic: why,
and what can be done to address the problem? BMC medicine 10, 87.
Dick, F. A., and Rubin, S. M. (2013). Molecular mechanisms underlying RB protein function.
Nature reviews Molecular cell biology 14, 297-306.
Doan, T., Melvold, R., Viselli, S., and Valtenbaugh, C. (2012). Immunology, 2 edn).
Donato, R., Cannon, B. R., Sorci, G., Riuzzi, F., Hsu, K., Weber, D. J., and Geczy, C. L.
(2013). Functions of S100 proteins. Current molecular medicine 13, 24-57.
Duan, L., Wu, R., Zou, Z., Wang, H., Ye, L., Li, H., Yuan, S., Li, X., Zha, H., Sun, H., et al.
(2014). S100A6 stimulates proliferation and migration of colorectal carcinoma cells through
activation of the MAPK pathways. International journal of oncology 44, 781-790.
Duffy, M. J. (2001). Carcinoembryonic antigen as a marker for colorectal cancer: is it
clinically useful? Clinical chemistry 47, 624-630.
Duffy, M. J. (2006). Serum tumor markers in breast cancer: are they of clinical value? Clinical
chemistry 52, 345-351.
Duffy, M. J. (2013a). Tumor markers in clinical practice: a review focusing on common solid
cancers. Medical principles and practice : international journal of the Kuwait University,
Health Science Centre 22, 4-11.
Duffy, M. J. (2013b). The war on cancer: are we winning? Tumour biology : the journal of the
International Society for Oncodevelopmental Biology and Medicine 34, 1275-1284.
Dvorak, H. F. (1986). Tumors: wounds that do not heal. Similarities between tumor stroma
generation and wound healing. The New England journal of medicine 315, 1650-1659.
E
Eckert, R. L., Broome, A. M., Ruse, M., Robinson, N., Ryan, D., and Lee, K. (2004). S100
proteins in the epidermis. The Journal of investigative dermatology 123, 23-33.
Efferson, C. L., Schickli, J., Ko, B. K., Kawano, K., Mouzi, S., Palese, P., Garcia-Sastre, A.,
and Ioannides, C. G. (2003). Activation of tumor antigen-specific cytotoxic T lymphocytes
(CTLs) by human dendritic cells infected with an attenuated influenza A virus expressing a
CTL epitope derived from the HER-2/neu proto-oncogene. Journal of virology 77, 7411-7424.
Eguchi, M., Masuda, H., and Asahara, T. (2007). Endothelial progenitor cells for postnatal
vasculogenesis. Clinical and experimental nephrology 11, 18-25.
El-Rifai, W., Moskaluk, C. A., Abdrabbo, M. K., Harper, J., Yoshida, C., Riggins, G. J.,
Frierson, H. F., Jr., and Powell, S. M. (2002). Gastric cancers overexpress S100A calcium binding proteins. Cancer research 62, 6823-6826.
Emberley, E. D., Alowami, S., Snell, L., Murphy, L. C., and Watson, P. H. (2004). S100A7
(psoriasin) expression is associated with aggressive features and alteration of Jab1 in ductal
carcinoma in situ of the breast. Breast cancer research : BCR 6, R308-315.
213
Emberley, E. D., Gietz, R. D., Campbell, J. D., HayGlass, K. T., Murphy, L. C., and Watson,
P. H. (2002). RanBPM interacts with psoriasin in vitro and their expression correlates with
specific clinical features in vivo in breast cancer. BMC cancer 2, 28.
Emberley, E. D., Niu, Y., Curtis, L., Troup, S., Mandal, S. K., Myers, J. N., Gibson, S. B.,
Murphy, L. C., and Watson, P. H. (2005). The S100A7-c-Jun activation domain binding
protein 1 pathway enhances prosurvival pathways in breast cancer. Cancer research 65,
5696-5702.
Emberley, E. D., Niu, Y., Leygue, E., Tomes, L., Gietz, R. D., Murphy, L. C., and Watson, P.
H. (2003a). Psoriasin interacts with Jab1 and influences breast cancer progression. Cancer
research 63, 1954-1961.
Emberley, E. D., Niu, Y., Njue, C., Kliewer, E. V., Murphy, L. C., and Watson, P. H. (2003b).
Psoriasin (S100A7) expression is associated with poor outcome in estrogen receptornegative invasive breast cancer. Clinical cancer research : an official journal of the American
Association for Cancer Research 9, 2627-2631.
Enerback, C., Porter, D. A., Seth, P., Sgroi, D., Gaudet, J., Weremowicz, S., Morton, C. C.,
Schnitt, S., Pitts, R. L., Stampl, J., et al. (2002). Psoriasin expression in mammary epithelial
cells in vitro and in vivo. Cancer research 62, 43-47.
Ewert, S., Honegger, A., and Pluckthun, A. (2004). Stability improvement of antibodies for
extracellular and intracellular applications: CDR grafting to stable frameworks and structurebased framework engineering. Methods 34, 184-199.
Ewing, J. (1928). Neoplastic Diseases: A Treatise on Tumors, (Philadelphia, New York,
USA: WB Saunders Company).
F
Ferrara, N. (2002). VEGF and the quest for tumour angiogenesis factors. Nature reviews
Cancer 2, 795-803.
Ferrara, N., Hillan, K. J., Gerber, H. P., and Novotny, W. (2004). Discovery and development
of bevacizumab, an anti-VEGF antibody for treating cancer. Nature reviews Drug discovery
3, 391-400.
Flatmark, K., Pedersen, K. B., Nesland, J. M., Rasmussen, H., Aamodt, G., Mikalsen, S. O.,
Bjornland, K., Fodstad, O., and Maelandsmo, G. M. (2003). Nuclear localization of the
metastasis-related protein S100A4 correlates with tumour stage in colorectal cancer. The
Journal of pathology 200, 589-595.
Folkman, J. (1971). Tumor angiogenesis: therapeutic implications. The New England journal
of medicine 285, 1182-1186.
Foote, J., and Winter, G. (1992). Antibody framework residues affecting the conformation of
the hypervariable loops. Journal of molecular biology 224, 487-499.
Forst, B., Hansen, M. T., Klingelhofer, J., Moller, H. D., Nielsen, G. H., Grum-Schwensen, B.,
Ambartsumian, N., Lukanidin, E., and Grigorian, M. (2010). Metastasis-inducing S100A4 and
RANTES cooperate in promoting tumor progression in mice. PloS one 5, e10374.
214
Bib liografia
Fridlender, Z. G., Sun, J., Kim, S., Kapoor, V., Cheng, G., Ling, L., Worthen, G. S., and
Albelda, S. M. (2009). Polarization of tumor-associated neutrophil phenotype by TGF-beta:
"N1" versus "N2" TAN. Cancer cell 16, 183-194.
Fruci, D., Lo Monaco, E., Cifaldi, L., Locatelli, F., Tremante, E., Benevolo, M., and Giacomini,
P. (2013). T and NK cells: two sides of tumor immunoevasion. Journal of translational
medicine 11, 30.
Fuentes, M. K., Nigavekar, S. S., Arumugam, T., Logsdon, C. D., Schmidt, A. M., Park, J. C.,
and Huang, E. H. (2007). RAGE activation by S100P in colon cancer stimulates growth,
migration, and cell signaling pathways. Diseases of the colon and rectum 50, 1230-1240.
Fujii, S., Shimizu, K., Shimizu, T., and Lotze, M. T. (2001). Interleukin-10 promotes the
maintenance of antitumor CD8(+) T-cell effector function in situ. Blood 98, 2143-2151.
Fukumura, D., Duda, D. G., Munn, L. L., and Jain, R. K. (2010). Tumor microvasculature and
microenvironment: novel insights through intravital imaging in pre-clinical models.
Microcirculation 17, 206-225.
Fulda, S. (2010). Evasion of apoptosis as a cellular stress response in cancer. International
journal of cell biology 2010, 370835.
G
Gagnon, A., Kim, J. H., Schorge, J. O., Ye, B., Liu, B., Hasselblatt, K., Welch, W. R.,
Bandera, C. A., and Mok, S. C. (2008). Use of a combination of approaches to identify and
validate relevant tumor-associated antigens and their corresponding autoantibodies in
ovarian cancer patients. Clinical cancer research : an official journal of the American
Association for Cancer Research 14, 764-771.
Garraway, L. A., and Janne, P. A. (2012). Circumventing cancer drug resistance in the era of
personalized medicine. Cancer discovery 2, 214-226.
Gay, L. J., and Felding-Habermann, B. (2011). Contribution of platelets to tumour metastasis.
Nature reviews Cancer 11, 123-134.
Georgiou, G., Ippolito, G. C., Beausang, J., Busse, C. E., Wardemann, H., and Quake, S. R.
(2014). The promise and challenge of high-throughput sequencing of the antibody repertoire.
Nature biotechnology 32, 158-168.
Ghanem, G., Loir, B., Morandini, R., Sales, F., Lienard, D., Eggermont, A., Lejeune, F., and
Group, E. M. (2001). On the release and half-life of S100B protein in the peripheral blood of
melanoma patients. International journal of cancer Journal international du cancer 94, 586590.
Ghavami, S., Rashedi, I., Dattilo, B. M., Eshraghi, M., Chazin, W. J., Hashemi, M.,
Wesselborg, S., Kerkhoff, C., and Los, M. (2008). S100A8/A9 at low concentration promotes
tumor cell growth via RAGE ligation and MAP kinase-dependent pathway. Journal of
leukocyte biology 83, 1484-1492.
Gialeli, C., Theocharis, A. D., and Karamanos, N. K. (2011). Roles of matrix
metalloproteinases in cancer progression and their pharmacological targeting. The FEBS
journal 278, 16-27.
215
Giudicelli, V., Chaume, D., and Lefranc, M. P. (2004). IMGT/V-QUEST, an integrated
software program for immunoglobulin and T cell receptor V-J and V-D-J rearrangement
analysis. Nucleic acids research 32, W435-440.
Glaser, R., Meyer-Hoffert, U., Harder, J., Cordes, J., Wittersheim, M., Kobliakova, J., FolsterHolst, R., Proksch, E., Schroder, J. M., and Schwarz, T. (2009). The antimicrobial protein
psoriasin (S100A7) is upregulated in atopic dermatitis and after experimental skin barrier
disruption. The Journal of investigative dermatology 129, 641-649.
Glassman, P. M., and Balthasar, J. P. (2014). Mechanistic considerations for the use of
monoclonal antibodies for cancer therapy. Cancer biology & medicine 11, 20-33.
Globocan (2012). International Agency for Research on Cancer (IARC). In.
Goda, S., Imai, T., Yoshie, O., Yoneda, O., Inoue, H., Nagano, Y., Okazaki, T., Imai, H.,
Bloom, E. T., Domae, N., and Umehara, H. (2000). CX3C-chemokine, fractalkine-enhanced
adhesion of THP-1 cells to endothelial cells through integrin-dependent and -independent
mechanisms. Journal of immunology 164, 4313-4320.
Goyal, A., Failla, M. D., Niyonkuru, C., Amin, K., Fabio, A., Berger, R. P., and Wagner, A. K.
(2013). S100b as a prognostic biomarker in outcome prediction for patients with severe
traumatic brain injury. Journal of neurotrauma 30, 946-957.
Greaves, N. S., Ashcroft, K. J., Baguneid, M., and Bayat, A. (2013). Current understanding of
molecular and cellular mechanisms in fibroplasia and angiogenesis during acute wound
healing. Journal of dermatological science 72, 206-217.
Gross, S. R., Sin, C. G., Barraclough, R., and Rudland, P. S. (2014). Joining S100 proteins
and migration: for better or for worse, in sickness and in health. Cellular and molecular life
sciences : CMLS 71, 1551-1579.
Grubbs, F. E. (1969). Procedures for Detecting Outlying Observations in Samples.
Technometrics 11, 21.
Gupta, H., Dai, L., Datta, G., Garber, D. W., Grenett, H., Li, Y., Mishra, V., Palgunachari, M.
N., Handattu, S., Gianturco, S. H., et al. (2005). Inhibition of lipopolysaccharide-induced
inflammatory responses by an apolipoprotein AI mimetic peptide. Circulation research 97,
236-243.
Gutschalk, C. M., Yanamandra, A. K., Linde, N., Meides, A., Depner, S., and Mueller, M. M.
(2013). GM-CSF enhances tumor invasion by elevated MMP-2, -9, and -26 expression.
Cancer medicine 2, 117-129.
H
Haase-Kohn, C., Wolf, S., Lenk, J., and Pietzsch, J. (2011). Copper-mediated cross-linking
of S100A4, but not of S100A2, results in proinflammatory effects in melanoma cells.
Biochemical and biophysical research communications 413, 494-498.
Hagens, G., Masouye, I., Augsburger, E., Hotz, R., Saurat, J. H., and Siegenthaler, G.
(1999). Calcium-binding protein S100A7 and epidermal-type fatty acid-binding protein are
associated in the cytosol of human keratinocytes. The Biochemical journal 339 ( Pt 2), 419427.
216
Bib liografia
Hanahan, D. (2014). Rethinking the war on cancer. Lancet 383, 558-563.
Hanahan, D., and Folkman, J. (1996). Patterns and emerging mechanisms of the angiogenic
switch during tumorigenesis. Cell 86, 353-364.
Hanahan, D., and Weinberg, R. A. (2000). The hallmarks of cancer. Cell 100, 57-70.
Hanahan, D., and Weinberg, R. A. (2011). Hallmarks of cancer: the next generation. Cell
144, 646-674.
Harding, F. A., Stickler, M. M., Razo, J., and DuBridge, R. B. (2010). The imm unogenicity of
humanized and fully human antibodies: residual immunogenicity resides in the CDR regions.
mAbs 2, 256-265.
Hattinger, E., Zwicker, S., Ruzicka, T., Yuspa, S. H., and Wolf, R. (2013). Opposing functions
of psoriasin (S100A7) and koebnerisin (S100A15) in epithelial carcinogenesis. Current
opinion in pharmacology 13, 588-594.
Hattori, F., Kiatsurayanon, C., Okumura, K., Ogawa, H., Ikeda, S., Okamoto, K., and
Niyonsaba, F. (2014). The antimicrobial protein S100A7/psoriasin enhances expression of
keratinocyte differentiation markers and strengthens the skin tight junction barrier. The British
journal of dermatology.
Hau, C. S., Kanda, N., Noda, S., Tatsuta, A., Kamata, M., Shibata, S., Asano, Y., Sato, S.,
Watanabe, S., and Tada, Y. (2013). Visfatin enhances the production of cathelicidin
antimicrobial peptide, human beta-defensin-2, human beta-defensin-3, and S100A7 in
human keratinocytes and their orthologs in murine imiquimod-induced psoriatic skin. The
American journal of pathology 182, 1705-1717.
Hegyi, Z., Zwicker, S., Bureik, D., Peric, M., Koglin, S., Batycka-Baran, A., Prinz, J. C.,
Ruzicka, T., Schauber, J., and Wolf, R. (2012). Vitamin D analog calcipotriol suppresses the
Th17 cytokine-induced proinflammatory S100 "alarmins" psoriasin (S100A7) and koebnerisin
(S100A15) in psoriasis. The Journal of investigative dermatology 132, 1416-1424.
Heizmann, C. W., and Cox, J. A. (1998). New perspectives on S100 proteins: a multifunctional Ca(2+)-, Zn(2+)- and Cu(2+)-binding protein family. Biometals : an international
journal on the role of metal ions in biology, biochemistry, and medicine 11, 383-397.
Heizmann, C. W., Fritz, G., and Schafer, B. W. (2002). S100 proteins: structure, functions
and pathology. Frontiers in bioscience : a journal and virtual library 7, d1356-1368.
Heldin, C. H. (2013). Targeting the PDGF signaling pathway in tumor treatment. Cell
communication and signaling : CCS 11, 97.
Hernan, R., Fasheh, R., Calabrese, C., Frank, A. J., Maclean, K. H., Allard, D., Barraclough,
R., and Gilbertson, R. J. (2003). ERBB2 up-regulates S100A4 and several other
prometastatic genes in medulloblastoma. Cancer research 63, 140-148.
Hernandez, J. L., Padilla, L., Dakhel, S., Coll, T., Hervas, R., Adan, J., Masa, M., Mitjans, F.,
Martinez, J. M., Coma, S., et al. (2013). Therapeutic targeting of tumor growth and
angiogenesis with a novel anti-S100A4 monoclonal antibody. PloS one 8, e72480.
Hesketh, R. (2013). Introduction to Cancer Biology, 1 edn: Cambridge university Press).
Hlushchuk, R., Riesterer, O., Baum, O., Wood, J., Gruber, G., Pruschy, M., and Djonov, V.
(2008). Tumor recovery by angiogenic switch from sprouting to intussusceptive angiogenesis
217
after treatment with PTK787/ZK222584 or ionizing radiation. The American journal of
pathology 173, 1173-1185.
Hoeben, A., Landuyt, B., Highley, M. S., Wildiers, H., Van Oosterom, A. T., and De Bruijn, E.
A. (2004). Vascular endothelial growth factor and angiogenesis. Pharmacological reviews 56,
549-580.
Hu, H., Zhang, Q., Huang, C., Shen, Y., Chen, X., Shi, X., and Tang, W. (2014). Diagnostic
value of S100P for pancreatic cancer: a meta-analysis. Tumour biology : the journal of the
International Society for Oncodevelopmental Biology and Medicine.
Hu, M., Ye, L., Ruge, F., Zhi, X., Zhang, L., and Jiang, W . G. (2012). The clinical significance
of Psoriasin for non-small cell lung cancer patients and its biological impact on lung cancer
cell functions. BMC cancer 12, 588.
Hua, Z., Chen, J., Sun, B., Zhao, G., Zhang, Y., Fong, Y., Jia, Z., and Yao, L. (2011).
Specific expression of osteopontin and S100A6 in hepatocellular carcinoma. Surgery 149,
783-791.
Huang, Y., Song, N., Ding, Y., Yuan, S., Li, X., Cai, H., Shi, H., and Luo, Y. (2009).
Pulmonary vascular destabilization in the premetastatic phase facilitates lung metastasis.
Cancer research 69, 7529-7537.
Hubmacher, D., and Apte, S. S. (2013). The biology of the extracellular matrix: novel
insights. Current opinion in rheumatology 25, 65-70.
Humphries, M. J. (2009). Cell adhesion assays. Methods in molecular biology 522, 203-210.
Hung, C. F., Huang, T. F., Chen, B. H., Shieh, J. M., Wu, P. H., and Wu, W. B. (2008).
Lycopene inhibits TNF-alpha-induced endothelial ICAM-1 expression and monocyteendothelial adhesion. European journal of pharmacology 586, 275-282.
Hussain, T., and Nguyen, Q. T. (2014). Molecular imaging for cancer diagnosis and surgery.
Advanced drug delivery reviews 66, 90-100.
I
Ichikawa, M., Williams, R., Wang, L., Vogl, T., and Srikrishna, G. (2011). S100A8/A9 activate
key genes and pathways in colon tumor progression. Molecular cancer research : MCR 9,
133-148.
InflammatoRX (2014). In.
Isaacs, J. T., Antony, L., Dalrymple, S. L., Brennen, W. N., Gerber, S., Hammers, H.,
Wissing, M., Kachhap, S., Luo, J., Xing, L., et al. (2013). Tasquinimod Is an Allosteric
Modulator of HDAC4 survival signaling within the compromised cancer microenvironment.
Cancer research 73, 1386-1399.
Issaq, H. J., Waybright, T. J., and Veenstra, T. D. (2011). Cancer biomarker discovery:
Opportunities and pitfalls in analytical methods. Electrophoresis 32, 967-975.
218
Bib liografia
J
Jansen, S., Podschun, R., Leib, S. L., Grotzinger, J., Oestern, S., Michalek, M., Pufe, T., and
Brandenburg, L. O. (2013). Expression and function of psoriasin (S100A7) and koebnerisin
(S100A15) in the brain. Infection and immunity 81, 1788-1797.
Jenkinson, S. R., Barraclough, R., West, C. R., and Rudland, P. S. (2004). S100A4 regulates
cell motility and invasion in an in vitro model for breast cancer metastasis. British journal of
cancer 90, 253-262.
Ji, J., Zhao, L., Wang, X., Zhou, C., Ding, F., Su, L., Zhang, C., Mao, X., Wu, M., and Liu, Z.
(2004). Differential expression of S100 gene family in human esophageal squamous cell
carcinoma. Journal of cancer research and clinical oncology 130, 480-486.
Jiang, L., Lai, Y. K., Zhang, J., Wang, H., Lin, M. C., He, M. L., and Kung, H. F. (2011).
Targeting S100P inhibits colon cancer growth and metastasis by Lentivirus -mediated RNA
interference and proteomic analysis. Molecular medicine 17, 709-716.
Jin, Q., Chen, H., Luo, A., Ding, F., and Liu, Z. (2011). S100A14 stimulates cell proliferation
and induces cell apoptosis at different concentrations via receptor for advanced glycation
end products (RAGE). PloS one 6, e19375.
Jinquan, T., Vorum, H., Larsen, C. G., Madsen, P., Rasmussen, H. H., Gesser, B., Etzerodt,
M., Honore, B., Celis, J. E., and Thestrup-Pedersen, K. (1996). Psoriasin: a novel
chemotactic protein. The Journal of investigative dermatology 107, 5-10.
Jones, P. T., Dear, P. H., Foote, J., Neuberger, M. S., and Winter, G. (1986). Replacing the
complementarity-determining regions in a human antibody with those from a mouse. Nature
321, 522-525.
Joyce, J. A. (2005). Therapeutic targeting of the tumor microenvironment. Cancer cell 7, 513520.
Joyce, N. C., Harris, D. L., and Mello, D. M. (2002). Mechanisms of mitotic inhibition in
corneal endothelium: contact inhibition and TGF-beta2. Investigative ophthalmology & visual
science 43, 2152-2159.
Jun, J. I., and Lau, L. F. (2011). Taking aim at the extracellular matrix: CCN proteins as
emerging therapeutic targets. Nature reviews Drug discovery 10, 945-963.
Junqueira, L. C., Bignolas, G., and Brentani, R. R. (1979). Picrosirius staining plus
polarization microscopy, a specific method for collagen detection in tis sue sections. The
Histochemical journal 11, 447-455.
K
Kalluri, R., and Weinberg, R. A. (2009). The basics of epithelial-mesenchymal transition. The
Journal of clinical investigation 119, 1420-1428.
Kang, J. H., Hwang, S. M., and Chung, I. Y. (2014). S100A8, S100A9, and S100A12 activate
airway epithelial cells to produce MUC5AC via ERK and NF-kappaB pathways. Immunology.
Kaplan, R. N., Riba, R. D., Zacharoulis, S., Bramley, A. H., Vincent, L., Costa, C.,
MacDonald, D. D., Jin, D. K., Shido, K., Kerns, S. A., et al. (2005). VEGFR1-positive
219
haematopoietic bone marrow progenitors initiate the pre-metastatic niche. Nature 438, 820827.
Karagiannis, G. S., Poutahidis, T., Erdman, S. E., Kirsch, R., Riddell, R. H., and Diamandis,
E. P. (2012). Cancer-associated fibroblasts drive the progression of metastasis through both
paracrine and mechanical pressure on cancer tissue. Molecular cancer research : MCR 10,
1403-1418.
Kataoka, K., Ono, T., Murata, H., Morishita, M., Yamamoto, K. I., Sakaguchi, M., and Huh, N.
H. (2012). S100A7 promotes the migration and invasion of osteosarcoma cells via the
receptor for advanced glycation end products. Oncology letters 3, 1149-1153.
Kaur, J., Matta, A., Kak, I., Srivastava, G., Assi, J., Leong, I., Witterick, I., Colgan, T. J.,
Macmillan, C., Siu, K. W., et al. (2014). S100A7 overexpression is a predictive marker for
high risk of malignant transformation in oral dysplasia. International journal of cancer Journal
international du cancer 134, 1379-1388.
Kawaguchi, M., and Kataoka, H. (2014). Mechanisms of hepatocyte growth factor activation
in cancer tissues. Cancers 6, 1890-1904.
Kerkhoff, C., Sorg, C., Tandon, N. N., and Nacken, W. (2001). Interaction of
S100A8/S100A9-arachidonic acid complexes with the scavenger receptor CD36 may
facilitate fatty acid uptake by endothelial cells. Biochemistry 40, 241-248.
Kessenbrock, K., Plaks, V., and Werb, Z. (2010). Matrix metalloproteinases: regulators of the
tumor microenvironment. Cell 141, 52-67.
Kesting, M. R., Sudhoff, H., Hasler, R. J., Nieberler, M., Pautke, C., Wolff, K. D., Wagenpfeil,
S., Al-Benna, S., Jacobsen, F., and Steinstraesser, L. (2009). Psoriasin (S100A7) upregulation in oral squamous cell carcinoma and its relation to clinicopathologic features. Oral
oncology 45, 731-736.
Kharaishvili, G., Simkova, D., Bouchalova, K., Gachechiladze, M., Narsia, N., and Bouchal,
J. (2014). The role of cancer-associated fibroblasts, solid stress and other
microenvironmental factors in tumor progression and therapy resistance. Cancer cell
international 14, 41.
Khazaeli, M. B., Conry, R. M., and LoBuglio, A. F. (1994). Human immune response to
monoclonal antibodies. Journal of immunotherapy with emphasis on tumor immunology :
official journal of the Society for Biological Therapy 15, 42-52.
Kim, H. J., Kang, H. J., Lee, H., Lee, S. T., Yu, M. H., Kim, H., and Lee, C. (2009).
Identification of S100A8 and S100A9 as serological markers for colorectal cancer. Journal of
proteome research 8, 1368-1379.
Kim, Y. N., Koo, K. H., Sung, J. Y., Yun, U. J., and Kim, H. (2012). Anoikis resistance: an
essential prerequisite for tumor metastasis. International journal of cell biology 2012, 306879.
Kimura, H., Sakai, K., Arao, T., Shimoyama, T., Tamura, T., and Nishio, K. (2007). Antibodydependent cellular cytotoxicity of cetuximab against tumor cells with wild-type or mutant
epidermal growth factor receptor. Cancer science 98, 1275-1280.
Kizawa, K., Jinbo, Y., Inoue, T., Takahara, H., Unno, M., Heizmann, C. W., and Izumi, Y.
(2013). Human S100A3 tetramerization propagates Ca(2+)/Zn(2+) binding states. Biochimica
et biophysica acta 1833, 1712-1719.
220
Bib liografia
Klein, C. A. (2008). Cancer. The metastasis cascade. Science 321, 1785-1787.
Klingelhofer, J., Grum-Schwensen, B., Beck, M. K., Knudsen, R. S., Grigorian, M., Lukanidin,
E., and Ambartsumian, N. (2012). Anti-S100A4 antibody suppresses metastasis formation by
blocking stroma cell invasion. Neoplasia 14, 1260-1268.
Klingelhofer, J., Senolt, L., Baslund, B., Nielsen, G. H., Skibshoj, I., Pavelka, K., Neidhart, M.,
Gay, S., Ambartsumian, N., Hansen, B. S., et al. (2007). Up-regulation of metastasispromoting S100A4 (Mts-1) in rheumatoid arthritis: putative involvement in the pathogenesis
of rheumatoid arthritis. Arthritis and rheumatism 56, 779-789.
Klug, S. J., Ressing, M., Koenig, J., Abba, M. C., Agorastos, T., Brenna, S. M., Ciotti, M.,
Das, B. R., Del Mistro, A., Dybikowska, A., et al. (2009). TP53 codon 72 polymorphism and
cervical cancer: a pooled analysis of individual data from 49 studies. The Lancet Oncology
10, 772-784.
Knapinska, A., and Fields, G. B. (2012). Chemical biology for understanding matrix
metalloproteinase function. Chembiochem : a European journal of chemical biology 13,
2002-2020.
Kobayashi, H., Boelte, K. C., and Lin, P. C. (2007). Endothelial cell adhesion molecules and
cancer progression. Current medicinal chemistry 14, 377-386.
Kohler, G., and Milstein, C. (1975). Continuous cultures of fused cells secreting antibody of
predefined specificity. Nature 256, 495-497.
Kong, J. P., Ding, F., Zhou, C. N., Wang, X. Q., Miao, X. P., Wu, M., and Liu, Z. H. (2004).
Loss of myeloid-related proteins 8 and myeloid-related proteins 14 expression in human
esophageal squamous cell carcinoma correlates with poor differentiation. World journal of
gastroenterology : WJG 10, 1093-1097.
Krop, I., Marz, A., Carlsson, H., Li, X., Bloushtain-Qimron, N., Hu, M., Gelman, R., Sabel, M.
S., Schnitt, S., Ramaswamy, S., et al. (2005). A putative role for psoriasin in breast tumor
progression. Cancer research 65, 11326-11334.
Kwon, C. H., Moon, H. J., Park, H. J., Choi, J. H., and Park do, Y. (2013). S100A8 and
S100A9 promotes invasion and migration through p38 mitogen-activated protein kinasedependent NF-kappaB activation in gastric cancer cells. Molecules and cells 35, 226-234.
Kwon, M., Caplan, J. F., Filipenko, N. R., Choi, K. S., Fitzpatrick, S. L., Zhang, L., and
Waisman, D. M. (2002). Identification of annexin II heterotetramer as a plasmin reductase.
The Journal of biological chemistry 277, 10903-10911.
L
Lam, H. W., Lin, H. C., Lao, S. C., Gao, J. L., Hong, S. J., Leong, C. W., Yue, P. Y., Kwan, Y.
W., Leung, A. Y., Wang, Y. T., and Lee, S. M. (2008). The angiogenic effects of Angelica
sinensis extract on HUVEC in vitro and zebrafish in vivo. Journal of cellular biochemistry 103,
195-211.
Landegren, U. (1984). Measurement of cell numbers by means of the endogenous enzyme
hexosaminidase. Applications to detection of lymphokines and cell surface antigens. Journal
of immunological methods 67, 379-388.
221
Leclerc, E., Fritz, G., Vetter, S. W., and Heizmann, C. W. (2009). Binding of S100 proteins to
RAGE: an update. Biochimica et biophysica acta 1793, 993-1007.
Leeb, T., Bruhn, O., Philipp, U., Kuiper, H., Regenhard, P., Paul, S., Distl, O., Chowdhary, B.
P., Kalm, E., and Looft, C. (2005). Assignment of the equine S100A7 gene (psoriasin 1) to
chromosome 5p12-->p13 by fluorescence in situ hybridization and radiation hybrid mapping.
Cytogenetic and genome research 109, 533.
Leenders, W. P., Kusters, B., and de Waal, R. M. (2002). Vessel co-option: how tumors
obtain blood supply in the absence of sprouting angiogenesis. Endothelium : journal of
endothelial cell research 9, 83-87.
Lemmon, M. A., and Schlessinger, J. (2010). Cell signaling by receptor tyrosine kinases. Cell
141, 1117-1134.
Li, C., Chen, H., Ding, F., Zhang, Y., Luo, A., Wang, M., and Liu, Z. (2009). A novel p53
target gene, S100A9, induces p53-dependent cellular apoptosis and mediates the p53
apoptosis pathway. The Biochemical journal 422, 363-372.
Li, C. L., Martinez, V., He, B., Lombet, A., and Perbal, B. (2002). A role for CCN3 (NOV) in
calcium signalling. Molecular pathology : MP 55, 250-261.
Liang, J., Zhang, Z., Liang, L., Shen, Y., and Ouyang, K. (2014). HIF-1alpha regulated
tongue squamous cell carcinoma cell growth via regulating VEGF expression in a xenograft
model. Annals of translational medicine 2, 92.
Limaverde-Sousa, G., Sternberg, C., and Ferreira, C. G. (2014). Antiangiogenesis beyond
VEGF inhibition: a journey from antiangiogenic single-target to broad-spectrum agents.
Cancer treatment reviews 40, 548-557.
Liu, H., Wang, L., Wang, X., Cao, Z., Yang, Q., and Zhang, K. (2013). S100A7 enhances
invasion of human breast cancer MDA-MB-468 cells through activation of nuclear factorkappaB signaling. World journal of surgical oncology 11, 93.
Liu, L., and Shi, G. P. (2012). CD31: beyond a marker for endothelial cells. Cardiovascular
research 94, 3-5.
Liu, R., Mori, S., Wake, H., Zhang, J., Liu, K., Izushi, Y., Takahashi, H. K., Peng, B., and
Nishibori, M. (2009). Establishment of in vitro binding assay of high mobility group box-1 and
S100A12 to receptor for advanced glycation endproducts: heparin's effect on binding. Acta
medica Okayama 63, 203-211.
Liu, Y. F., Liu, Q. Q., Wang, X., and Luo, C. H. (2014). Clinical significance of S100A2
expression in gastric cancer. Tumour biology : the journal of the International Society for
Oncodevelopmental Biology and Medicine 35, 3731-3741.
Lonberg, N. (2008). Fully human antibodies from transgenic mouse and phage display
platforms. Current opinion in immunology 20, 450-459.
Lopez-Dee, Z., Pidcock, K., and Gutierrez, L. S. (2011). Thrombospondin-1: multiple paths to
inflammation. Mediators of inflammation 2011, 296069.
Lovly, C. M., Yu, H. A., and Riely, G. J. (2014). Therapeutic Strategies Utilized in the Setting
of Acquired Resistance to EGFR Tyrosine Kinase Inhibitors. Clinical cancer research : an
official journal of the American Association for Cancer Research.
222
Bib liografia
Lu, M., Miller, P., and Lu, X. (2014). Restoring the tumour suppressive function of p53 as a
parallel strategy in melanoma therapy. FEBS letters 588, 2616-2621.
Lu, P., Weaver, V. M., and Werb, Z. (2012). The extracellular matrix: a dynamic niche in
cancer progression. The Journal of cell biology 196, 395-406.
Luis-Ravelo, D., Anton, I., Zandueta, C., Valencia, K., Ormazabal, C., Martinez-Canarias, S.,
Guruceaga, E., Perurena, N., Vicent, S., De Las Rivas, J., and Lecanda, F. (2013). A gene
signature of bone metastatic colonization sensitizes for tumor-induced osteolysis and
predicts survival in lung cancer. Oncogene.
M
Ma, C. X., Sanchez, C. G., and Ellis, M. J. (2009). Predicting endocrine therapy
responsiveness in breast cancer. Oncology (Williston Park) 23, 133-142.
Mabert, K., Cojoc, M., Peitzsch, C., Kurth, I., Souchelnytskyi, S., and Dubrovska, A. (2014).
Cancer biomarker discovery: current status and future perspectives. International journal of
radiation biology 90, 659-677.
Madar, S., Goldstein, I., and Rotter, V. (2013). 'Cancer associated fibroblasts'--more than
meets the eye. Trends in molecular medicine 19, 447-453.
Madsen, P., Rasmussen, H. H., Leffers, H., Honore, B., Dejgaard, K., Olsen, E., Kiil, J.,
Walbum, E., Andersen, A. H., Basse, B., and et al. (1991). Molecular cloning, occurrence,
and expression of a novel partially secreted protein "psoriasin" that is highly up-regulated in
psoriatic skin. The Journal of investigative dermatology 97, 701-712.
Mahon, P. C., Baril, P., Bhakta, V., Chelala, C., Caulee, K., Harada, T., and Lemoine, N. R.
(2007). S100A4 contributes to the suppression of BNIP3 expression, chemoresistance, and
inhibition of apoptosis in pancreatic cancer. Cancer research 67, 6786-6795.
Malashkevich, V. N., Dulyaninova, N. G., Ramagopal, U. A., Liriano, M. A., Varney, K. M.,
Knight, D., Brenowitz, M., Weber, D. J., Almo, S. C., and Bresnick, A. R. (2010).
Phenothiazines inhibit S100A4 function by inducing protein oligomerization. Proceedings of
the National Academy of Sciences of the United States of America 107, 8605-8610.
Mandal, S., Curtis, L., Pind, M., Murphy, L. C., and Watson, P. H. (2007). S100A7 (psoriasin)
influences immune response genes in human breast cancer. Experimental cell research 313,
3016-3025.
Mandinova, A., Atar, D., Schafer, B. W., Spiess, M., Aebi, U., and Heizmann, C. W. (1998).
Distinct subcellular localization of calcium binding S100 proteins in human smooth muscle
cells and their relocation in response to rises in intracellular calcium. Journal of cell science
111 ( Pt 14), 2043-2054.
Marenholz, I., Heizmann, C. W., and Fritz, G. (2004). S100 proteins in mouse and man: from
evolution to function and pathology (including an update of the nomenclature). Biochemical
and biophysical research communications 322, 1111-1122.
Martin, A. C. (1996). Accessing the Kabat antibody sequence database by computer.
Proteins 25, 130-133.
223
Martin, A. C. (2010). Protein Sequence and Structure Analysis of Antibody Variable
Domains. In Antibody engineering, R. Kontermann, and S. Dübel, eds. (Germany: Springer),
p. 589.
McMullen, M. E., Bryant, P. W., Glembotski, C. C., Vincent, P. A., and Pumiglia, K. M.
(2005). Activation of p38 has opposing effects on the proliferation and migration of
endothelial cells. The Journal of biological chemistry 280, 20995-21003.
Menon, U., Griffin, M., and Gentry-Maharaj, A. (2014). Ovarian cancer screening--current
status, future directions. Gynecologic oncology 132, 490-495.
Merelli, B., Massi, D., Cattaneo, L., and Mandala, M. (2014). Targeting the PD1/PD-L1 axis
in melanoma: biological rationale, clinical challenges and opportunities. Critical reviews in
oncology/hematology 89, 140-165.
Miele, E., Markowitz, J. E., Mamula, P., and Baldassano, R. N. (2004). Human antichimeric
antibody in children and young adults with inflammatory bowel disease receiving infliximab.
Journal of pediatric gastroenterology and nutrition 38, 502-508.
Miller, K., Wang, M., Gralow, J., Dickler, M., Cobleigh, M., Perez, E. A., Shenkier, T., Cella,
D., and Davidson, N. E. (2007). Paclitaxel plus bevacizumab versus paclitaxel alone for
metastatic breast cancer. The New England journal of medicine 357, 2666-2676.
Miller, M. C., Doyle, G. V., and Terstappen, L. W. (2010). Significance of Circulating Tumor
Cells Detected by the CellSearch System in Patients with Metastatic Breast Colorectal and
Prostate Cancer. Journal of oncology 2010, 617421.
Mina, L. A., and Sledge, G. W., Jr. (2011). Rethinking the metastatic cascade as a
therapeutic target. Nature reviews Clinical oncology 8, 325-332.
Mittal, K., Ebos, J., and Rini, B. (2014). Angiogenesis and the tumor microenvironment:
vascular endothelial growth factor and beyond. Seminars in oncology 41, 235-251.
Morgan, M. R., Jazayeri, M., Ramsay, A. G., Thomas, G. J., Boulanger, M. J., Hart, I. R., and
Marshall, J. F. (2011). Psoriasin (S100A7) associates with integrin beta6 subunit and is
required for alphavbeta6-dependent carcinoma cell invasion. Oncogene 30, 1422-1435.
Moroz, O. V., Wilson, K. S., and Bronstein, I. B. (2011). The role of zinc in the S100 proteins:
insights from the X-ray structures. Amino acids 41, 761-772.
Moserle, L., Amadori, A., and Indraccolo, S. (2009). The angiogenic switch: implications in
the regulation of tumor dormancy. Current molecular medicine 9, 935-941.
Moss, A. (2013). The angiopoietin:Tie 2 interaction: a potential target for future therapies in
human vascular disease. Cytokine & growth factor reviews 24, 579-592.
Moubayed, N., Weichenthal, M., Harder, J., Wandel, E., Sticherling, M., and Glaser, R.
(2007). Psoriasin (S100A7) is significantly up-regulated in human epithelial skin tumours.
Journal of cancer research and clinical oncology 133, 253-261.
Mougiakakos, D., Choudhury, A., Lladser, A., Kiessling, R., and Johansson, C. C. (2010).
Regulatory T cells in cancer. Advances in cancer research 107, 57-117.
Mukhopadhyay, D., Tsiokas, L., and Sukhatme, V. P. (1998). High cell density induces
vascular endothelial growth factor expression via protein tyrosine phosphorylation. Gene
expression 7, 53-60.
224
Bib liografia
Multhoff, G., Radons, J., and Vaupel, P. (2014). Critical role of ab errant angiogenesis in the
development of tumor hypoxia and associated radioresistance. Cancers 6, 813-828.
N
Nagy, J. A., Chang, S. H., Shih, S. C., Dvorak, A. M., and Dvorak, H. F. (2010).
Heterogeneity of the tumor vasculature. Seminars in thrombosis and hemostasis 36, 321331.
Nasser, M. W., Qamri, Z., Deol, Y. S., Ravi, J., Powell, C. A., Trikha, P., Schwendener, R. A.,
Bai, X. F., Shilo, K., Zou, X., et al. (2012). S100A7 enhances mammary tumorigenesis
through upregulation of inflammatory pathways. Cancer research 72, 604-615.
Nault, J. C., Bioulac-Sage, P., and Zucman-Rossi, J. (2013). Hepatocellular benign tumorsfrom molecular classification to personalized clinical care. Gastroenterology 144, 888-902.
NCI (2014). NCI Dictionary of cancer terms. In.
NCI (Updated 03/07/2014). Defining Cancer. National Cancer Institute.
Nedjadi, T., Kitteringham, N., Campbell, F., Jenkins, R. E., Park, B. K., Navarro, P., Ashcroft,
F., Tepikin, A., Neoptolemos, J. P., and Costello, E. (2009). S100A6 binds to annexin 2 in
pancreatic cancer cells and promotes pancreatic cancer cell motility. British journal of cancer
101, 1145-1154.
Nguyen, D. X., Bos, P. D., and Massague, J. (2009). Metastasis: from dissemination to
organ-specific colonization. Nature reviews Cancer 9, 274-284.
Ning, X., Sun, S., Hong, L., Liang, J., Liu, L., Han, S., Liu, Z., Shi, Y., Li, Y., Gong, W., et al.
(2007). Calcyclin-binding protein inhibits proliferation, tumorigenicity, and invasion of gastric
cancer. Molecular cancer research : MCR 5, 1254-1262.
Nishikawa, H., and Sakaguchi, S. (2010). Regulatory T cells in tumor immunity. International
journal of cancer Journal international du cancer 127, 759-767.
Noble, J. E., and Bailey, M. J. (2009). Quantitation of protein. Methods in enzymology 463,
73-95.
Noel, A., Gutierrez-Fernandez, A., Sounni, N. E., Behrendt, N., Maquoi, E., Lund, I. K., Cal,
S., Hoyer-Hansen, G., and Lopez-Otin, C. (2012). New and paradoxical roles of matrix
metalloproteinases in the tumor microenvironment. Frontiers in pharmacology 3, 140.
Noy, R., and Pollard, J. W. (2014). Tumor-associated macrophages: from mechanisms to
therapy. Immunity 41, 49-61.
O
O'Neil, B. H., Cainap, C., Van Cutsem, E., Gorbunova, V., Karapetis, C. S., Berlin, J.,
Goldberg, R. M., Qin, Q., Qian, J., Ricker, J. L., et al. (2014). Randomized Phase II OpenLabel Study of mFOLFOX6 in Combination With Linifanib or Bevacizumab for Metastatic
Colorectal Cancer. Clinical colorectal cancer 13, 156-163 e152.
Ohuchida, K., Mizumoto, K., Miyasaka, Y., Yu, J., Cui, L., Yamaguchi, H., Toma, H.,
Takahata, S., Sato, N., Nagai, E., et al. (2007). Over-expression of S100A2 in pancreatic
225
cancer correlates with progression and poor prognosis. The Journal of pathology 213, 275282.
Oida, Y., Yamazaki, H., Tobita, K., Mukai, M., Ohtani, Y., Miyazaki, N., Abe, Y., Imaizumi, T.,
Makuuchi, H., Ueyama, Y., and Nakamura, M. (2006). Increased S100A4 expression
combined with decreased E-cadherin expression predicts a poor outcome of patients with
pancreatic cancer. Oncology reports 16, 457-463.
Okada, M., Tokumitsu, H., Kubota, Y., and Kobayashi, R. (2002). Interaction of S100
proteins with the antiallergic drugs, olopatadine, amlexanox, and cromolyn: identification of
putative drug binding sites on S100A1 protein. Biochemical and biophysical research
communications 292, 1023-1030.
OMS (2014). Fact sheet N°297. In.
Oskarsson, T. (2013). Extracellular matrix components in breast cancer progression and
metastasis. Breast 22 Suppl 2, S66-72.
Ostergaard, M., Wolf, H., Orntoft, T. F., and Celis, J. E. (1999). Psoriasin (S100A7): a
putative urinary marker for the follow-up of patients with bladder squamous cell carcinomas.
Electrophoresis 20, 349-354.
Osterreicher, C. H., Penz-Osterreicher, M., Grivennikov, S. I., Guma, M., Koltsova, E. K.,
Datz, C., Sasik, R., Hardiman, G., Karin, M., and Brenner, D. A. (2011). Fibroblast-specific
protein 1 identifies an inflammatory subpopulation of macrophages in the liver. Proceedings
of the National Academy of Sciences of the United States of America 108, 308-313.
Ott, C., Jacobs, K., Haucke, E., Navarrete Santos, A., Grune, T., and Simm, A. (2014). Role
of advanced glycation end products in cellular signaling. Redox biology 2, 411-429.
P
Padilla, L., Dakhel, S., and Hernandez, J. L. (2014). S100 to receptor for advanced glycation
end-products binding assay: looking for inhibitors. Biochemical and biophysical research
communications 446, 404-409.
Page, D. B., Postow, M. A., Callahan, M. K., Allison, J. P., and Wolchok, J. D. (2014).
Immune modulation in cancer with antibodies. Annual review of medicine 65, 185-202.
Paget, S. (1889). The distribution of secondary growths in cancer of the breast. The Lancet
133, 571-573.
Pantel, K., and Brakenhoff, R. H. (2004). Dissecting the metastatic cascade. Nature reviews
Cancer 4, 448-456.
Paruchuri, V., Prasad, A., McHugh, K., Bhat, H. K., Polyak, K., and Ganju, R. K. (2008).
S100A7-downregulation inhibits epidermal growth factor-induced signaling in breast cancer
cells and blocks osteoclast formation. PloS one 3, e1741.
Patan, S. (2004). Vasculogenesis and angiogenesis. Cancer treatment and research 117, 332.
Patan, S., Munn, L. L., and Jain, R. K. (1996). Intussusceptive microvascular growth in a
human colon adenocarcinoma xenograft: a novel mechanism of tumor angiogenesis.
Microvascular research 51, 260-272.
226
Bib liografia
Peinado, H., Lavotshkin, S., and Lyden, D. (2011). The secreted factors responsible for premetastatic niche formation: old sayings and new thoughts. Seminars in cancer biology 21,
139-146.
Perona, R. (2006). Cell signalling: growth factors and tyrosine kinase receptors. Clinical &
translational oncology : official publication of the Federation of Spanish Oncology Societies
and of the National Cancer Institute of Mexico 8, 77-82.
Perryman, L., and Erler, J. T. (2014). Lysyl oxidase in cancer research. Future oncology 10,
1709-1717.
Petersson, S., Bylander, A., Yhr, M., and Enerback, C. (2007). S100A7 (Psoriasin), highly
expressed in ductal carcinoma in situ (DCIS), is regulated by IFN-gamma in mammary
epithelial cells. BMC cancer 7, 205.
Phipps, K. D., Surette, A. P., O'Connell, P. A., and Waisman, D. M. (2011). Plasminogen
receptor S100A10 is essential for the migration of tumor-promoting macrophages into tumor
sites. Cancer research 71, 6676-6683.
Piccart, M. J. (2001). Proposed treatment guidelines for HER2-positive metastatic breast
cancer in Europe. Annals of oncology : official journal of the European Society for Medical
Oncology / ESMO 12 Suppl 1, S89-94.
Pietras, K., and Ostman, A. (2010). Hallmarks of cancer: interactions with the tumor stroma.
Experimental cell research 316, 1324-1331.
Piura, B., and Piura, E. (2009). Autoantibodies to tumor-associated antigens in epithelial
ovarian carcinoma. Journal of oncology 2009, 581939.
Poruk, K. E., Gay, D. Z., Brown, K., Mulvihill, J. D., Boucher, K. M., Scaife, C. L., Firpo, M.
A., and Mulvihill, S. J. (2013). The clinical utility of CA 19-9 in pancreatic adenocarcinoma:
diagnostic and prognostic updates. Current molecular medicine 13, 340-351.
Poyet, C., Hof, D., Sulser, T., and Muntener, M. (2012). Artificial prostate-specific antigen
persistence after radical prostatectomy. Journal of clinical oncology : official journal of the
American Society of Clinical Oncology 30, e62-63.
Presta, L. G. (2006). Engineering of therapeutic antibodies to minimize immunogenicity and
optimize function. Advanced drug delivery reviews 58, 640-656.
Principe, D. R., Doll, J. A., Bauer, J., Jung, B., Munshi, H. G., Bartholin, L., Pasche, B., Lee,
C., and Grippo, P. J. (2014). TGF-beta: duality of function between tumor prevention and
carcinogenesis. Journal of the National Cancer Institute 106, djt369.
Proskuryakov, S. Y., and Gabai, V. L. (2010). Mechanisms of tumor cell necrosis. Current
pharmaceutical design 16, 56-68.
Psaila, B., and Lyden, D. (2009). The metastatic niche: adapting the foreign soil. Nature
reviews Cancer 9, 285-293.
Puverel, S., and Tessarollo, L. (2013). RanBPM, a scaffolding protein for gametogenesis.
Current topics in developmental biology 102, 357-384.
227
Q
Qin, W., Ho, L., Wang, J., Peskind, E., and Pasinetti, G. M. (2009). S100A7, a novel
Alzheimer's disease biomarker with non-amyloidogenic alpha-secretase activity acts via
selective promotion of ADAM-10. PloS one 4, e4183.
Quail, D. F., and Joyce, J. A. (2013). Microenvironmental regulation of tumor progression
and metastasis. Nature medicine 19, 1423-1437.
R
Ramana, K. V., Bhatnagar, A., and Srivastava, S. K. (2004). Inhibition of aldose reductase
attenuates TNF-alpha-induced expression of adhesion molecules in endothelial cells. FASEB
journal : official publication of the Federation of American Societies for Experimental Biology
18, 1209-1218.
Ranjan, A., and Kalraiya, R. D. (2014). Invasive Potential of Melanoma Cells Correlates with
the Expression of MT1-MMP and Regulated by Modulating Its Association with Motility
Receptors via N-Glycosylation on the Receptors. BioMed research international 2014,
804680.
Raymond, E., Dalgleish, A., Damber, J. E., Smith, M., and Pili, R. (2014). Mechanisms of
action of tasquinimod on the tumour microenvironment. Cancer chemotherapy and
pharmacology 73, 1-8.
Raza, A., Franklin, M. J., and Dudek, A. Z. (2010). Pericytes and vessel maturation during
tumor angiogenesis and metastasis. American journal of hematology 85, 593-598.
Reddy, T. R., Li, C., Guo, X., Myrvang, H. K., Fischer, P. M., and Dekker, L. V. (2011).
Design, synthesis, and structure-activity relationship exploration of 1-substituted 4-aroyl-3hydroxy-5-phenyl-1H-pyrrol-2(5H)-one analogues as inhibitors of the annexin A2-S100A10
protein interaction. Journal of medicinal chemistry 54, 2080-2094.
Renaud, W., Merten, M., and Figarella, C. (1994). Increased coexpression of CFTR and
S100 calcium binding proteins MRP8 and MRP14 mRNAs in cystic fibrosis human tracheal
gland cells. Biochemical and biophysical research communications 201, 1518-1525.
Rich, L., and Whittaker, P. (2005). COLLAGEN AND PICROSIRIUS RED STAINING: A
POLARIZED LIGHT ASSESSMENT OF FIBRILLAR HUE AND SPATIAL DISTRIBUTION.
Brazilian Journal of morphological Sciences 22 (2), 7.
Rich, N., and Singal, A. G. (2014). Hepatocellular carcinoma tumour markers: Current role
and expectations. Best practice & research Clinical gastroenterology 28, 843-853.
Ries, C. (2014). Cytokine functions of TIMP-1. Cellular and molecular life sciences : CMLS
71, 659-672.
Robert, J. (2013). [Biology of cancer metastasis]. Bulletin du cancer 100, 333-342.
Robinson, M. J., Tessier, P., Poulsom, R., and Hogg, N. (2002). The S100 family
heterodimer, MRP-8/14, binds with high affinity to heparin and heparan sulfate
glycosaminoglycans on endothelial cells. The Journal of biological chemistry 277, 36583665.
228
Bib liografia
Roh, M. S. (2014). Molecular pathology of lung cancer: current status and future directions.
Tuberculosis and respiratory diseases 77, 49-54.
Rohde, D., Ritterhoff, J., Voelkers, M., Katus, H. A., Parker, T. G., and Most, P. (2010).
S100A1: a multifaceted therapeutic target in cardiovascular disease. Journal of
cardiovascular translational research 3, 525-537.
Rolle, C. E., Sengupta, S., and Lesniak, M. S. (2012). Mechanisms of immune evasion by
gliomas. Advances in experimental medicine and biology 746, 53-76.
Rosen, L. S. (2002). Clinical experience with angiogenesis signaling inhibitors: focus on
vascular endothelial growth factor (VEGF) blockers. Cancer control : journal of the Moffitt
Cancer Center 9, 36-44.
Rosty, C., Ueki, T., Argani, P., Jansen, M., Yeo, C. J., Cameron, J. L., Hruban, R. H., and
Goggins, M. (2002). Overexpression of S100A4 in pancreatic ductal adenocarcinomas is
associated with poor differentiation and DNA hypomethylation. The American journal of
pathology 160, 45-50.
Ruse, M., Lambert, A., Robinson, N., Ryan, D., Shon, K. J., and Eckert, R. L. (2001).
S100A7, S100A10, and S100A11 are transglutaminase substrates. Biochemistry 40, 31673173.
Ryckman, C., Vandal, K., Rouleau, P., Talbot, M., and Tessier, P. A. (2003). Proinflammatory
activities of S100: proteins S100A8, S100A9, and S100A8/A9 induce neutrophil chemotaxis
and adhesion. Journal of immunology 170, 3233-3242.
S
Sabeh, F., Shimizu-Hirota, R., and Weiss, S. J. (2009). Protease-dependent versus independent cancer cell invasion programs: three-dimensional amoeboid movement
revisited. The Journal of cell biology 185, 11-19.
Sacha, T. (2014). Imatinib in chronic myeloid leukemia: an overview. Mediterranean journal
of hematology and infectious diseases 6, e2014007.
Saito, K., Nawata, M., Iwata, S., Tokunaga, M., and Tanaka, Y. (2005). Extremely high titer
of anti-human chimeric antibody following re-treatment with rituximab in a patient with active
systemic lupus erythematosus. Rheumatology 44, 1462-1464.
Sakurai, T., and Kudo, M. (2011). Signaling pathways governing tumor angiogenesis.
Oncology 81 Suppl 1, 24-29.
Sandler, A., Gray, R., Perry, M. C., Brahmer, J., Schiller, J. H., Dowlati, A., Lilenbaum, R.,
and Johnson, D. H. (2006). Paclitaxel-carboplatin alone or with bevacizumab for non-smallcell lung cancer. The New England journal of medicine 355, 2542-2550.
Santamaria-Kisiel, L., Rintala-Dempsey, A. C., and Shaw, G. S. (2006). Calcium-dependent
and -independent interactions of the S100 protein family. The Biochemical journal 396, 201214.
Scott, A. M., Wolchok, J. D., and Old, L. J. (2012). Antibody therapy of cancer. Nature
reviews Cancer 12, 278-287.
229
Schafer, M., and Werner, S. (2008). Cancer as an overhealing wound: an old hypothesis
revisited. Nature reviews Molecular cell biology 9, 628-638.
Schiffer, I. B., Gebhard, S., Heimerdinger, C. K., Heling, A., Hast, J., Wollscheid, U., Seliger,
B., Tanner, B., Gilbert, S., Beckers, T., et al. (2003). Switching off HER-2/neu in a
tetracycline-controlled mouse tumor model leads to apoptosis and tumor-size-dependent
remission. Cancer research 63, 7221-7231.
Schmidt-Hansen, B., Klingelhofer, J., Grum-Schwensen, B., Christensen, A., Andresen, S.,
Kruse, C., Hansen, T., Ambartsumian, N., Lukanidin, E., and Grigorian, M. (2004). Functional
significance of metastasis-inducing S100A4(Mts1) in tumor-stroma interplay. The Journal of
biological chemistry 279, 24498-24504.
Schweizer, M. T., and Carducci, M. A. (2013). From bevacizumab to tasquinimod:
angiogenesis as a therapeutic target in prostate cancer. Cancer journal 19, 99-106.
Seftor, R. E., Hess, A. R., Seftor, E. A., Kirschmann, D. A., Hardy, K. M., Margaryan, N. V.,
and Hendrix, M. J. (2012). Tumor cell vasculogenic mimicry: from controversy to therapeutic
promise. The American journal of pathology 181, 1115-1125.
Sekhri, K. (2014). Telomeres and telomerase: understanding basic structure and potential
new therapeutic strategies targeting it in the treatment of cancer. Journal of postgraduate
medicine 60, 303-308.
Seoane, J., and De Mattos-Arruda, L. (2014). Brain metastasis: New opportunities to tackle
therapeutic resistance. Molecular oncology 8, 1120-1131.
Sharma, P., Wagner, K., Wolchok, J. D., and Allison, J. P. (2011). Novel cancer
immunotherapy agents with survival benefit: recent successes and next steps. Nature
reviews Cancer 11, 805-812.
Shen, K., Ji, L., Lu, B., and Wang, Z. (2012). c-Jun N-terminal kinase mediated VEGFR2
sustained phosphorylation is critical for VEGFA-induced angiogenesis in vitro and in vivo.
Cell biochemistry and biophysics 64, 17-27.
Sheng, J. G., Mrak, R. E., Rovnaghi, C. R., Kozlowska, E., Van Eldik, L. J., and Griffin, W. S.
(1996). Human brain S100 beta and S100 beta mRNA expression increases with age:
pathogenic implications for Alzheimer's disease. Neurobiology of aging 17, 359-363.
Sherrill, B., Wang, J., Kotapati, S., and Chin, K. (2013). Q-TWiST analysis comparing
ipilimumab/dacarbazine vs placebo/dacarbazine for patients with stage III/IV melanoma.
British journal of cancer 109, 8-13.
Shibue, T., and Weinberg, R. A. (2011). Metastatic colonization: settlement, adaptation and
propagation of tumor cells in a foreign tissue environment. Seminars in cancer biology 21,
99-106.
Shibuya, M. (2014). VEGF-VEGFR Signals in Health and Disease. Biomolecules &
therapeutics 22, 1-9.
Shimizu, T., Hoshino, Y., Miyazaki, H., and Sato, E. (2012). Angiogenesis and
microvasculature in the female reproductive organs: physiological and pathological
implications. Current pharmaceutical design 18, 303-309.
230
Bib liografia
Shubbar, E., Vegfors, J., Carlstrom, M., Petersson, S., and Enerback, C. (2012). Psoriasin
(S100A7) increases the expression of ROS and VEGF and acts through RAGE to promote
endothelial cell proliferation. Breast cancer research and treatment 134, 71-80.
Shukla, S., and Meeran, S. M. (2014). Epigenetics of cancer stem cells: Pathways and
therapeutics. Biochimica et biophysica acta.
Sica, A., and Mantovani, A. (2012). Macrophage plasticity and polarization: in vivo veritas.
The Journal of clinical investigation 122, 787-795.
Siddique, H. R., Adhami, V. M., Parray, A., Johnson, J. J., Siddiqui, I. A., Shekhani, M. T.,
Murtaza, I., Ambartsumian, N., Konety, B. R., Mukhtar, H., and Saleem, M. (2013). The
S100A4 Oncoprotein Promotes Prostate Tumorigenesis in a Transgenic Mouse Model:
Regulating NFkappaB through the RAGE Receptor. Genes & cancer 4, 224-234.
Simanski, M., Rademacher, F., Schroder, L., Schumacher, H. M., Glaser, R., and Harder, J.
(2013). IL-17A and IFN-gamma synergistically induce RNase 7 expression via STAT3 in
primary keratinocytes. PloS one 8, e59531.
Skelton, N. J., Kordel, J., Akke, M., Forsen, S., and Chazin, W. J. (1994). Signal transduction
versus buffering activity in Ca(2+)-binding proteins. Nature structural biology 1, 239-245.
Slaney, C. Y., Rautela, J., and Parker, B. S. (2013). The emerging role of
immunosurveillance in dictating metastatic spread in breast cancer. Cancer research 73,
5852-5857.
Smith, H. A., and Kang, Y. (2013). The metastasis-promoting roles of tumor-associated
immune cells. Journal of molecular medicine 91, 411-429.
Sneh, A., Deol, Y. S., Ganju, A., Shilo, K., Rosol, T. J., Nasser, M. W., and Ganju, R. K.
(2013). Differential role of psoriasin (S100A7) in estrogen receptor alpha positive and
negative breast cancer cells occur through actin remodeling. Breast cancer research and
treatment 138, 727-739.
Sonoyama, T., Sakai, A., Mita, Y., Yasuda, Y., Kawamoto, H., Yagi, T., Yoshioka, M.,
Mimura, T., Nakachi, K., Ouchida, M., et al. (2011). TP53 codon 72 polymorphism is
associated with pancreatic cancer risk in males, smokers and drinkers. Molecular medicine
reports 4, 489-495.
Sorci, G., Riuzzi, F., Agneletti, A. L., Marchetti, C., and Donato, R. (2004). S100B causes
apoptosis in a myoblast cell line in a RAGE-independent manner. Journal of cellular
physiology 199, 274-283.
Sosman, J. A., Kim, K. B., Schuchter, L., Gonzalez, R., Pavlick, A. C., Weber, J. S.,
McArthur, G. A., Hutson, T. E., Moschos, S. J., Flaherty, K. T., et al. (2012). Survival in
BRAF V600-mutant advanced melanoma treated with vemurafenib. The New England
journal of medicine 366, 707-714.
Sotiropoulou, P. A., Christodoulou, M. S., Silvani, A., Herold-Mende, C., and Passarella, D.
(2014). Chemical approaches to targeting drug resistance in cancer stem cells. Drug
discovery today.
Sparvero, L. J., Asafu-Adjei, D., Kang, R., Tang, D., Amin, N., Im, J., Rutledge, R., Lin, B.,
Amoscato, A. A., Zeh, H. J., and Lotze, M. T. (2009). RAGE (Receptor for Advanced
231
Glycation Endproducts), RAGE ligands, and their role in cancer and inflammation. Journal of
translational medicine 7, 17.
Srikrishna, G., and Freeze, H. H. (2011). S100 Protein Family and Tumorigenesis. In,
(Sanford-Burnham Medical Research Institute, La Jolla, California ).
Stacker, S. A., Williams, S. P., Karnezis, T., Shayan, R., Fox, S. B., and Achen, M. G.
(2014). Lymphangiogenesis and lymphatic vessel remodelling in cancer. Nature reviews
Cancer 14, 159-172.
Stapor, P. C., Sweat, R. S., Dashti, D. C., Betancourt, A. M., and Murfee, W. L. (2014).
Pericyte Dynamics during Angiogenesis: New Insights from New Identities. Journal of
vascular research 51, 163-174.
Steeg, P. S. (2006). Tumor metastasis: mechanistic insights and clinical challenges. Nature
medicine 12, 895-904.
Steinert, G., Scholch, S., Niemietz, T., Iwata, N., Garcia, S. A., Behrens, B., Voigt, A., Kloor,
M., Benner, A., Bork, U., et al. (2014). Immune escape and survival mechanisms in
circulating tumor cells of colorectal cancer. Cancer research 74, 1694-1704.
Steinestel, K., Eder, S., Schrader, A. J., and Steinestel, J. (2014). Clinical significance of
epithelial-mesenchymal transition. Clinical and translational medicine 3, 17.
Steinman, R. A., Wentzel, A., Lu, Y., Stehle, C., and Grandis, J. R. (2003). Activation of Stat3
by cell confluence reveals negative regulation of Stat3 by cdk2. Oncogene 22, 3608-3615.
Strell, C., and Entschladen, F. (2008). Extravasation of leukocytes in comparison to tumor
cells. Cell communication and signaling : CCS 6, 10.
Stupack, D. G., and Cheresh, D. A. (2002). ECM remodeling regulates angiogenesis:
endothelial integrins look for new ligands. Science's STKE : signal transduction knowledge
environment 2002, pe7.
Stuttfeld, E., and Ballmer-Hofer, K. (2009). Structure and function of VEGF receptors. IUBMB
life 61, 915-922.
Sudhakar, A. (2009). History of Cancer, Ancient and Modern Treatment Methods. Journal of
cancer science & therapy 1, 1-4.
Sun, X. T., Ding, Y. T., Yan, X. G., Wu, L. Y., Li, Q., Cheng, N., Qiu, Y. D., and Zhang, M. Y.
(2004). Angiogenic synergistic effect of basic fibroblast growth factor and vasc ular
endothelial growth factor in an in vitro quantitative microcarrier-based three-dimensional
fibrin angiogenesis system. World journal of gastroenterology : WJG 10, 2524-2528.
Surova, O., and Zhivotovsky, B. (2013). Various modes of cell death induced by DNA
damage. Oncogene 32, 3789-3797.
Sussmuth, S. D., Tumani, H., Ecker, D., and Ludolph, A. C. (2003). Amyotrophic lateral
sclerosis: disease stage related changes of tau protein and S100 beta in cerebrospinal fluid
and creatine kinase in serum. Neuroscience letters 353, 57-60.
T
Thulin, E., Kesvatera, T., and Linse, S. (2011). Molecular determinants of S100B oligomer
formation. PloS one 6, e14768.
232
Bib liografia
Tiveron, R. C., de Freitas, L. C., Figueiredo, D. L., Serafini, L. N., Mamede, R. C., and Zago,
M. A. (2012). Expression of calcium binding protein S100 A7 (psoriasin) in laryngeal
carcinoma. Brazilian journal of otorhinolaryngology 78, 59-65.
Tripathi, S. C., Matta, A., Kaur, J., Grigull, J., Chauhan, S. S., Thakar, A., Shukla, N. K.,
Duggal, R., DattaGupta, S., Ralhan, R., and Siu, K. W. (2010). Nuclear S100A7 is associated
with poor prognosis in head and neck cancer. PloS one 5, e11939.
Tsai, C. S., Lin, F. Y., Chen, Y. H., Yang, T. L., Wang, H. J., Huang, G. S., Lin, C. Y., Tsai, Y.
T., Lin, S. J., and Li, C. Y. (2008). Cilostazol attenuates MCP-1 and MMP-9 expression in
vivo in LPS-administrated balloon-injured rabbit aorta and in vitro in LPS-treated monocytic
THP-1 cells. Journal of cellular biochemistry 103, 54-66.
Tyszkiewicz, T., Jarzab, M., Szymczyk, C., Kowal, M., Krajewska, J., Jaworska, M., Fraczek,
M., Krajewska, A., Hadas, E., Swierniak, M., et al. (2014). Epidermal differentiation complex
(locus 1q21) gene expression in head and neck cancer and normal mucosa. Folia
histochemica et cytobiologica / Polish Academy of Sciences, Polish Histochemical and
Cytochemical Society 52, 79-89.
V
Valastyan, S., and Weinberg, R. A. (2011). Tumor metastasis: molecular insights and
evolving paradigms. Cell 147, 275-292.
Valiente, M., Obenauf, A. C., Jin, X., Chen, Q., Zhang, X. H., Lee, D. J., Chaft, J. E., Kris, M.
G., Huse, J. T., Brogi, E., and Massague, J. (2014). Serpins promote cancer cell survival and
vascular co-option in brain metastasis. Cell 156, 1002-1016.
Van Cutsem, E., Li, C. P., Nowara, E., Aprile, G., Moore, M., Federowicz, I., Van Laethem, J.
L., Hsu, C., Tham, C. K., Stemmer, S. M., et al. (2014). Dose escalation to rash for erlotinib
plus gemcitabine for metastatic pancreatic cancer: the phase II RACHEL study. British
journal of cancer.
van Dieck, J., Teufel, D. P., Jaulent, A. M., Fernandez-Fernandez, M. R., Rutherford, T. J.,
Wyslouch-Cieszynska, A., and Fersht, A. R. (2009). Posttranslational modifications affect the
interaction of S100 proteins with tumor suppressor p53. Journal of molecular biology 394,
922-930.
Virchow, R. (1863). Cellular pathology, as based upon physiological and pathological
histology 1edn (Philadelphia: J. B. Lippincott).
Virtanen, T. (2006). Psoriasin and its allergenic bovine homolog Bos d 3. Cellular and
molecular life sciences : CMLS 63, 1091-1094.
Vlodavsky, I., Fuks, Z., Ishai-Michaeli, R., Bashkin, P., Levi, E., Korner, G., Bar-Shavit, R.,
and Klagsbrun, M. (1991). Extracellular matrix-resident basic fibroblast growth factor:
implication for the control of angiogenesis. Journal of cellular biochemistry 45, 167-176.
233
W
Wai, P. Y., Mi, Z., Guo, H., Sarraf-Yazdi, S., Gao, C., Wei, J., Marroquin, C. E., Clary, B., and
Kuo, P. C. (2005). Osteopontin silencing by small interfering RNA suppresses in vitro and in
vivo CT26 murine colon adenocarcinoma metastasis. Carcinogenesis 26, 741-751.
Wang, H. Y., Zhang, J. Y., Cui, J. T., Tan, X. H., Li, W. M., Gu, J., and Lu, Y. Y. (2010a).
Expression status of S100A14 and S100A4 correlates with metastatic potential and clinical
outcome in colorectal cancer after surgery. Oncology reports 23, 45-52.
Wang, L. J., Matoso, A., Sciandra, K. T., Yakirevich, E., Sabo, E., Zhang, Y., Meitner, P. A.,
Tavares, R., Noble, L., Pareek, G., et al. (2012). Expression of S100A4 in renal epithelial
neoplasms. Applied immunohistochemistry & molecular morphology : AIMM / official
publication of the Society for Applied Immunohistochemistry 20, 71-76.
Wang, X. J., and Wang, M. (2010). The S100 protein family and its application in cardiac
diseases. World journal of emergency medicine 1, 165-168.
Wang, Y. Y., Ye, Z. Y., Zhao, Z. S., Tao, H. Q., and Chu, Y. Q. (2010b). High-level
expression of S100A4 correlates with lymph node metastasis and poor prognosis in patients
with gastric cancer. Annals of surgical oncology 17, 89-97.
Wang, Z., and Huang, H. (2013). Platelet factor-4 (CXCL4/PF-4): an angiostatic chemokine
for cancer therapy. Cancer letters 331, 147-153.
Watson, P. H., Leygue, E. R., and Murphy, L. C. (1998). Psoriasin (S100A7). The
international journal of biochemistry & cell biology 30, 567-571.
Webb, M., Emberley, E. D., Lizardo, M., Alowami, S., Qing, G., Alfia'ar, A., Snell-Curtis, L. J.,
Niu, Y., Civetta, A., Myal, Y., et al. (2005). Expression analysis of the mouse
S100A7/psoriasin gene in skin inflammation and mammary tumorigenesis. BMC cancer 5,
17.
Weinberg, R. A. (2013). The Biology of Cancer, 2 edn: Garland Science).
Weis, S., Cui, J., Barnes, L., and Cheresh, D. (2004). Endothelial barrier disruption by VEGFmediated Src activity potentiates tumor cell extravasation and metastasis. The Journal of cell
biology 167, 223-229.
Wells, A., Griffith, L., Wells, J. Z., and Taylor, D. P. (2013). The dormancy dilemma:
quiescence versus balanced proliferation. Cancer research 73, 3811-3816.
West, N. R., and Watson, P. H. (2010). S100A7 (psoriasin) is induced by the
proinflammatory cytokines oncostatin-M and interleukin-6 in human breast cancer. Oncogene
29, 2083-2092.
Westin, J. R., and Kurzrock, R. (2012). It's about time: lessons for solid tumors from chronic
myelogenous leukemia therapy. Molecular cancer therapeutics 11, 2549-2555.
Wilgus, T. A. (2012). Growth Factor-Extracellular Matrix Interactions Regulate Wound
Repair. Advances in wound care 1, 249-254.
Winiarska, M., Glodkowska-Mrowka, E., Bil, J., and Golab, J. (2011). Molecular mechanisms
of the antitumor effects of anti-CD20 antibodies. Frontiers in bioscience 16, 277-306.
Wolf, R., Howard, O. M., Dong, H. F., Voscopoulos, C., Boeshans, K., Winston, J., Divi, R.,
Gunsior, M., Goldsmith, P., Ahvazi, B., et al. (2008). Chemotactic activity of S100A7
234
Bib liografia
(Psoriasin) is mediated by the receptor for advanced glycation end products and potentiates
inflammation with highly homologous but functionally distinct S100A15. Journal of
immunology 181, 1499-1506.
Wolf, R., Mirmohammadsadegh, A., Walz, M., Lysa, B., Tartler, U., Remus, R., Hengge, U.,
Michel, G., and Ruzicka, T. (2003). Molecular cloning and characterization of alternatively
spliced mRNA isoforms from psoriatic skin encoding a novel member of the S100 family.
FASEB journal : official publication of the Federation of American Societies for Experimental
Biology 17, 1969-1971.
Wolf, R., Voscopoulos, C., Winston, J., Dharamsi, A., Goldsmith, P., Gunsior, M.,
Vonderhaar, B. K., Olson, M., Watson, P. H., and Yuspa, S. H. (2009). Highly homologous
hS100A15 and hS100A7 proteins are distinctly expressed in normal breast tissue and breast
cancer. Cancer letters 277, 101-107.
Wolf, R., Voscopoulos, C. J., FitzGerald, P. C., Goldsmith, P., Cataisson, C., Gunsior, M.,
Walz, M., Ruzicka, T., and Yuspa, S. H. (2006). The mouse S100A15 ortholog parallels
genomic organization, structure, gene expression, and protein-processing pattern of the
human S100A7/A15 subfamily during epidermal maturation. The Journal of investigative
dermatology 126, 1600-1608.
X
Xiao, M. B., Jiang, F., Ni, W. K., Chen, B. Y., Lu, C. H., Li, X. Y., and Ni, R. Z. (2012). High
expression of S100A11 in pancreatic adenocarcinoma is an unfavorable prognostic marker.
Medical oncology 29, 1886-1891.
Xie, J., Mendez, J. D., Mendez-Valenzuela, V., and Aguilar-Hernandez, M. M. (2013).
Cellular signalling of the receptor for advanced glycation end products (RAGE). Cellular
signalling 25, 2185-2197.
Y
Yammani, R. R. (2012). S100 proteins in cartilage: role in arthritis. Biochimica et biophysica
acta 1822, 600-606.
Yang, H., Zhao, K., Yu, Q., Wang, X., Song, Y., and Li, R. (2012). Evaluation of plasma and
tissue S100A4 protein and mRNA levels as potential markers of metastasis and prognosis in
clear cell renal cell carcinoma. The Journal of international medical research 40, 475-485.
Yang, L., Pang, Y., and Moses, H. L. (2010). TGF-beta and immune cells: an important
regulatory axis in the tumor microenvironment and progression. Trends in immunology 31,
220-227.
Yao, R., Davidson, D. D., Lopez-Beltran, A., MacLennan, G. T., Montironi, R., and Cheng, L.
(2007a). The S100 proteins for screening and prognostic grading of bladder cancer.
Histology and histopathology 22, 1025-1032.
Yao, R., Lopez-Beltran, A., Maclennan, G. T., Montironi, R., Eble, J. N., and Cheng, L.
(2007b). Expression of S100 protein family members in the pathogenesis of bladder tumors.
Anticancer research 27, 3051-3058.
235
Yatime, L., and Andersen, G. R. (2013). Structural insights into the oligomerization mode of
the human receptor for advanced glycation end-products. The FEBS journal 280, 6556-6568.
Ye, L., Sun, P. H., Martin, T. A., Sanders, A. J., Mason, M. D., and Jiang, W. G. (2013).
Psoriasin (S100A7) is a positive regulator of survival and invasion of prostate cancer cells.
Urologic oncology 31, 1576-1583.
Yousfi Monod, M., Giudicelli, V., Chaume, D., and Lefranc, M. P. (2004).
IMGT/JunctionAnalysis: the first tool for the analysis of the immunoglobulin and T cell
receptor complex V-J and V-D-J JUNCTIONs. Bioinformatics 20 Suppl 1, i379-385.
Z
Zamarron, B. F., and Chen, W. (2011). Dual roles of immune cells and their factors in cancer
development and progression. International journal of biological sciences 7, 651-658.
Zhang, G., Li, M., Jin, J., Bai, Y., and Yang, C. (2011a). Knockdown of S100A4 decreases
tumorigenesis and metastasis in osteosarcoma cells by repression of matrix
metalloproteinase-9. Asian Pacific journal of cancer prevention : APJCP 12, 2075-2080.
Zhang, H., Wang, Y., Chen, Y., Sun, S., Li, N., Lv, D., Liu, C., Huang, L., He, D., and Xiao, X.
(2007). Identification and validation of S100A7 associated with lung squamous cell
carcinoma metastasis to brain. Lung cancer 57, 37-45.
Zhang, H., Zhao, Q., Chen, Y., Wang, Y., Gao, S., Mao, Y., Li, M., Peng, A., He, D., and
Xiao, X. (2008). Selective expression of S100A7 in lung squamous cell carcinomas and large
cell carcinomas but not in adenocarcinomas and small cell carcinomas. Thorax 63, 352-359.
Zhang, J., Alcaide, P., Liu, L., Sun, J., He, A., Luscinskas, F. W., and Shi, G. P. (2011b).
Regulation of endothelial cell adhesion molecule expression by mast cells, macrophages,
and neutrophils. PloS one 6, e14525.
Zhang, J., Zhang, K., Jiang, X., and Zhang, J. (2014). S100A6 as a Potential Serum
Prognostic Biomarker and Therapeutic Target in Gastric Cancer. Digestive diseases and
sciences 59, 2136-2144.
Zhe, X., Cher, M. L., and Bonfil, R. D. (2011). Circulating tumor cells: finding the needle in
the haystack. American journal of cancer research 1, 740-751.
Zhou, J., Schmid, T., Frank, R., and Brune, B. (2004). PI3K/Akt is required for heat shock
proteins to protect hypoxia-inducible factor 1alpha from pVHL-independent degradation. The
Journal of biological chemistry 279, 13506-13513.
Zhou, S., Huang, C., and Wei, Y. (2010). The metabolic switch and its regulation in cancer
cells. Science China Life sciences 53, 942-958.
Zhu, L., Okano, S., Takahara, M., Chiba, T., Tu, Y., Oda, Y., and Furue, M. (2013).
Expression of S100 protein family members in normal skin and sweat gland tumors. Journal
of dermatological science 70, 211-219.
Zibert, J. R., Skov, L., Thyssen, J. P., Jacobsen, G. K., and Grigorian, M. (2010).
Significance of the S100A4 protein in psoriasis. The Journal of investigative dermatology
130, 150-160.
236
Bib liografia
Zijlstra, A., Lewis, J., Degryse, B., Stuhlmann, H., and Quigley, J. P. (2008). The inhibition of
tumor cell intravasation and subsequent metastasis via regulation of in vivo tumor cell motility
by the tetraspanin CD151. Cancer cell 13, 221-234.
Zongo, D., Ribereau-Gayon, R., Masson, F., Laborey, M., Contrand, B., Salmi, L. R.,
Montaudon, D., Beaudeux, J. L., Meurin, A., Dousset, V., et al. (2012). S100-B protein as a
screening tool for the early assessment of minor head injury. Annals of emergency medicine
59, 209-218.
237
Pub licacions i Patents
239
Pub licacions i Patents
8. PUBLICACIONS I PATENTS
PUBLICACIONS
Nasser, M., Wani, N., Ahirwar, D., Powell, C., Elbaz, M., Zhao, H., Padilla, L., Zhang, X.,
Shilo, K., Ostrowski, M., Shapiro, C., and Ganju, R. (2014). RAGE/S100A7 axis enhances
breast cancer growth and metastasis through activation of Stat3 pathway. Cancer Research.
Minor Revision
Padilla, L., Dakhel, S., and Hernandez, J. L. (2014). S100 to receptor for advanced glycation
end-products binding assay: looking for inhibitors. Biochemical and biophysical research
communications 446, 404-409.
Dakhel S, Padilla L, Adan J, Masa M, Martinez JM, Roque L, Coll T, Hervas R, Calvis C,
Messeguer R, Mitjans F, Hernandez JL. (2014). S100P antibody-mediated therapy as a new
promising strategy for the treatment of pancreatic cancer. Oncogenesis 3, e92.
Rodriguez, L., Villalobos, X., Dakhel, S., Padilla, L., Hervas, R., Hernandez, J. L., Ciudad, C.
J., and Noe, V. (2013). Polypurine reverse Hoogsteen hairpins as a gene therapy tool
against survivin in human prostate cancer PC3 cells in vitro and in vivo. Biochemical
pharmacology 86, 1541-1554.
Hernandez JL, Padilla L, Dakhel S, Coll T, Hervas R, Adan J, Masa M, Mitjans F, Martinez
JM, Coma S, Rodriguez L, Noe V, Ciudad CJ, Blasco F, Messeguer R. (2013). Therapeutic
targeting of tumor growth and angiogenesis with a novel anti-S100A4 monoclonal antibody.
PloS one 8, e72480.
CONTRIBUCIÓ A CONGRESSOS
Congrés: ECCO2013
Lloc de celebració: Amsterdam, Holanda Data: 2013
Tipus de participació: Presentació de Pòster
Títol: Assessing the potential of S100A7 as target for tumor therapy using neutralizing
monoclonal antibodies
Autors: Hernandez JL, Padilla L, Dakhel S, Adan J, Martinez JM, Masa M, Messeguer R,
Mitjans F.
Congrés: ECCO2013
Lloc de celebració: Amsterdam, Holanda Data: 2013
Tipus de participació: Presentació de Pòster
Títol: Targeting extracellular S100P: therapeutic potential of monoclonal antibodies
Autors: Hernandez JL, Padilla L, Dakhel S, Adan J, Martinez JM, Masa M, Messeguer R,
Mitjans F.
241
Congrés: ECCO2013
Lloc de celebració: Amsterdam, Holanda Data: 2013
Tipus de participació: Presentació de Pòster
Títol: S100A4 neutralizing mAbs for the treatment of cancer
Autors: Hernandez JL, Padilla L, Dakhel S, Adan J, Martinez JM, Masa M, Messeguer R,
Mitjans F.
Congrés: EACR
Lloc de celebració: Barcelona, España
Data: 2012
Tipus de participació: Presentació de Pòster
Títol: New strategy for the inhibition of tumor cell proliferation and tumor metastasis by using
anti-S100P monoclonal antibodies
Autors: Hernandez JL, Dakhel S, Padilla L, Adan J, Martinez JM, Masa M, Messeguer R,
Mitjans F, Coll T, Hervas R.
Congrés: EACR
Lloc de celebració: Barcelona, España
Data: 2012
Tipus de participació: Presentació de Pòster
Títol: S100A4 acts synergistically with VEGF to promote angiogenesis and a neutralizing
monoclonal antibody against S100A4 could be a first in class strategy to combat solid tumors
Autors: Hernandez JL, Dakhel S, Padilla L, Adan J, Martinez JM, Masa M, Messeguer R,
Mitjans F, Coll T, Hervas R.
Congrés: Cell Symposia
Lloc de celebració: Brussel·les, Bèlgica
Data: 2012
Tipus de participació: Presentació de Pòster
Títol: Neutralizing activity of a novel monoclonal antibody against S100A4 protei n: an
strategy for anti-angiogeneic theraphy in cancer
Autors: Hernandez JL, Dakhel S, Padilla L, Adan J, Martinez JM, Masa M, Messeguer R,
Mitjans F, Coll T, Hervas R.
PATENTS
WO/2011/157724: S100A4 ANTIBODIES AND THERAPEUTIC USES THEREOF. José Luis
Hernández, Jaume Adan, Josep Maria Martínez, Marc Masa, Ramon Messeguer, Francesc
Mitjans, Antonio Coll, Rosa Mª Hervas, Carme Calvis, Sheila Dakhel, Laura Padilla.
WO/2012/098124: ANTIBODIES AGAINST THE S100P PROTEIN FOR THE TREATMENT
AND DIAGNOSIS OF CANCER. José Luis Hernández, Jaume Adan, Josep Maria Martínez,
Marc Masa, Ramon Messeguer, Francesc Mitjans, Antonio Coll, Rosa Mª Hervas, Carme
Calvis, Sheila Dakhel, Laura Padilla.
WO/2014/167030: ANTI-S100A7 ANTIBODIES FOR THE TREATMENT AND DIAGNOSIS
OF CANCER. José Luis Hernández, Jaume Adan, Josep Maria Martínez, Marc Masa,
Ramon Messeguer, Francesc Mitjans, Antonio Coll, Rosa Mª Hervas, Carme Calvis, Sheila
Dakhel, Laura Padilla.
242
Pub licacions i Patents
243
244
Pub licacions i Patents
245
246
Pub licacions i Patents
247
248
Pub licacions i Patents
249
250
Pub licacions i Patents
251
252
Pub licacions i Patents
253
254
Pub licacions i Patents
255
256
Pub licacions i Patents
257
258
Pub licacions i Patents
259
Pub licacions i Patents
261
262
Pub licacions i Patents
263
264
Pub licacions i Patents
265
266
Pub licacions i Patents
267
268
Pub licacions i Patents
269
270
d’introduir noves estratègies terapèutiques, basades en un major
!
" #
$%&#
com a diana terapèutica i l’ús d’anticossos monoclonals específics
'!
Fly UP